KEGG   Thermococcus peptonophilus: A0127_03105Help
Entry
A0127_03105       CDS       T04728                                 

Definition
(GenBank) hypothetical protein
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
tpep  Thermococcus peptonophilus
Brite
KEGG Orthology (KO) [BR:tpep00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tpep03016]
    A0127_03105
Enzymes [BR:tpep01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     A0127_03105
Transfer RNA biogenesis [BR:tpep03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    A0127_03105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TYW3 Rnk_N
Motif
Other DBs
NCBI-ProteinID: AMQ18226
UniProt: A0A142CTX4
Position
594608..595204
Genome map
AA seq 198 aa AA seqDB search
MFLYTENFEEQKEKAMEGLRKALEEDRVDHDIIPLLEKINALPNYFTTSSCSGRISVMEM
PHFGDKVNSVWLGKWHREVRLEEVLEAVRKHRSGQLWFLVRSPILHVGARTLEDAVRLLN
LAIGLGFKYSNIKSVSHKKLVVEIRSTERMDVPLGENGELWVDEAYIERIVTLANAQVRR
FKAKLKRLEEEIERLSEV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtttctctacaccgagaactttgaagagcagaaggaaaaggcgatggaaggcctgagg
aaggcccttgaagaggacagggtagaccatgacataatcccgctcctggagaagataaac
gccctcccaaactacttcacgacttcctcatgctcgggaaggatttcggtcatggagatg
cctcacttcggcgacaaggtgaactctgtgtggctcggcaagtggcacagggaggtcagg
ctcgaagaagtccttgaggctgtgagaaaacaccgctccggccagctctggtttctggtc
aggagtccaatactccacgttggggcgagaactcttgaggacgctgtgagactgttaaac
cttgccataggcctgggctttaagtactccaacataaagagcgtgagccacaagaagctg
gtcgttgagatacgttcaacagagaggatggacgtcccgctgggcgagaacggggaactg
tgggttgatgaggcatacatcgagagaatagtcacccttgcaaacgcccaggtcagaagg
ttcaaggcgaagctgaagaggctggaagaggaaattgaacgcttatctgaggtttga

DBGET integrated database retrieval system