KEGG   Thermococcus peptonophilus: A0127_06460Help
Entry
A0127_06460       CDS       T04728                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
tpep  Thermococcus peptonophilus
Pathway
tpep00627  Aminobenzoate degradation
tpep01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tpep00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    A0127_06460
Enzymes [BR:tpep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     A0127_06460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 PGP_phosphatase
Motif
Other DBs
NCBI-ProteinID: AMQ19531
UniProt: A0A142CXM9
Position
complement(1219549..1220355)
Genome map
AA seq 268 aa AA seqDB search
MTRKIGIIFDMDGVIYRGSEPIKGARELIEFLKAKKIPFLFLTNNSTRDPAMYREKLLSM
SIDVPEEVIITSGLATRLYMERHFEPGDIFVIGGKGLLREMERLGWGVVGLEDARKGAWK
RIKHVVVGLDPGLTYEKLKYGTLAIRNGASFIGTNPDTTYPAEEGLYPGAGAIIAALKAS
TDREPLIIGKPNEPAYEVVKDKIGDVEGLWMVGDRLDTDIAFAKRFGMKAIMVLTGVSTL
RDVAESEIKPDLVLPDVGELKRYLEAVL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgacgagaaaaatcggcattatcttcgacatggacggcgtcatctacagaggcagcgag
ccaataaagggcgcgagagagcttatcgagttcctgaaagcgaagaaaatacccttcctg
ttcctcacgaacaactcaacgagagaccccgcaatgtaccgggaaaagctcctctcgatg
agcatagacgtgccggaagaggttataatcacgtcgggccttgccacaaggctctacatg
gagaggcacttcgaacccggagatatctttgtcatcggtggaaaggggcttctcagggag
atggagcgcctcggctggggggtcgttggccttgaagatgctaggaaaggcgcctggaag
agaatcaagcacgtcgttgtgggcctcgaccctgggctaacctacgagaagctcaagtac
ggaacgctcgccataaggaacggggcgagcttcatcggaaccaacccggacacgacctat
ccagcggaggagggtctctaccccggtgctggggcaataatagcagcactcaaagcatca
acggacagagagccactgatcatcggcaagcccaacgaacctgcctatgaagttgtcaag
gacaagattggggacgttgaagggctctggatggtcggcgacaggctcgatactgatata
gcgttcgcaaagcgcttcggcatgaaggccataatggtgctcacgggcgtcagcacgctc
agggacgttgccgaaagcgagataaagccggacctcgttctcccggatgtgggggagctg
aaaaggtacctggaggctgtcctttag

DBGET integrated database retrieval system