KEGG   Tetrapisispora phaffii: TPHA_0C01780Help
Entry
TPHA_0C01780      CDS       T02235                                 

Gene name
TPHA0C01780
Definition
(RefSeq) hypothetical protein
  KO
K06655  negative regulator of the PHO system [EC:2.7.11.22]
Organism
tpf  Tetrapisispora phaffii
Pathway
tpf04111  Cell cycle - yeast
tpf04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:tpf00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    TPHA_0C01780 (TPHA0C01780)
  09143 Cell growth and death
   04111 Cell cycle - yeast
    TPHA_0C01780 (TPHA0C01780)
Enzymes [BR:tpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     TPHA_0C01780 (TPHA0C01780)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH DUF4160
Motif
Other DBs
NCBI-GeneID: 11534076
NCBI-ProteinID: XP_003684768
UniProt: G8BRF8
Position
3:complement(407048..407965)
Genome map
AA seq 305 aa AA seqDB search
MSSSSSQFKQLEKLGNGTYATVYKGLNKTTGIFVALKEVKLDSEEGTPSTAIREISLMKE
LKHENIVRLYDVIHTENKLTLVFEYMDKDLKNYMDSRTSGNSTRGLELSLVKYFQWQLFE
GVTFCHENKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFSTEVVTLWYRAPDV
LMGSRSYSTSIDMWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPDEQLWPAVTSL
PKYNRNLPKKEPKDLKKLLQAHTKEIVDDQVIDLVTGLLQLNPDARLTAKQALHHPWFGE
YYQQQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatcatcttctcaatttaagcaattagaaaaattgggtaacggtacctatgcc
actgtttataaagggttgaataagactaccggtatatttgtagctttaaaagaagtcaaa
ctggattcagaagaaggtacaccatcgactgctatccgtgaaatttctttgatgaaagaa
ttgaaacatgagaatattgtgagattatatgatgttatacatactgaaaataaattgacg
ttagtttttgaatacatggataaagatttaaagaattatatggattcgagaacatccggt
aattctactagagggttagaattaagtttagtcaaatatttccaatggcaattatttgaa
ggtgttacattttgtcatgaaaacaagatcttacatcgtgatttaaaaccacagaattta
ttaataaataataaagggcaattgaaattaggtgattttggtttagcgcgtgcttttggt
atcccagtaaacactttttctactgaagtggttactctttggtatagagctccagatgtc
ttgatgggatcaagatcatattctacttctattgatatgtggtcttgtggctgtatcttg
gctgaaatgataacaggtaaacctctcttcccaggtacaaatgacgaagaacagttgaaa
ttgatttttgatattatggggactcctgatgaacagttgtggccagctgttacatcgtta
ccaaaatataatagaaatttacctaagaaagaaccaaaggacttgaaaaaattattacaa
gctcatactaaggagatagttgatgatcaagtgattgatttagtaactggattactacaa
ttgaatcctgatgcaagattaactgccaaacaggcattgcaccatccctggtttggggaa
tattaccaacaacaataa

DBGET integrated database retrieval system