KEGG   Tetrapisispora phaffii: TPHA_0D03140Help
Entry
TPHA_0D03140      CDS       T02235                                 

Gene name
TPHA0D03140
Definition
(RefSeq) hypothetical protein
  KO
K17498  transcription factor SPN1
Organism
tpf  Tetrapisispora phaffii
Brite
KEGG Orthology (KO) [BR:tpf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:tpf03021]
    TPHA_0D03140 (TPHA0D03140)
Transcription machinery [BR:tpf03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     TPHA_0D03140 (TPHA0D03140)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Med26 T3SS_HrpK1 Phasin
Motif
Other DBs
NCBI-GeneID: 11531015
NCBI-ProteinID: XP_003685384
UniProt: G8BSX9
Position
4:complement(651748..652860)
Genome map
AA seq 370 aa AA seqDB search
METVESATYVEQPAVVQNRDGDEDNVRVERKRKHIDVDGSDNDSDVDINKINQMPGSNNV
TAGSGNLSNDAELDSATRTRKELEDKLDKLLKKPKVRRSRQDEDDLEQYLDEKILRLKDE
MNIAAQMDIETLNKRIETNDKSLIAVQKVKLLPKVVSILSKANLADTILDNNLLQSVRIW
LEPLPDGSLPSFEIQKSLFAALNKLPIKTEHLKESGLGRVVIFYTKSKRVEAPLPRIAEK
LIAEWTRPIIGASDNYRDKRILKLEFDAEKLRKKSALDNAKNRKKQKNGSEEPRSRSEGS
SAQSLYEDAAARRGRAAAPAQTTTDYKYAPVSNAGALSSNLRSNGVGSSLNNSETYKRLI
SRLNKSKKSK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggagactgtagaaagtgccacttatgtcgaacaacctgctgttgtgcaaaatcgtgat
ggtgatgaagataatgttagagtagagaggaagcgcaaacatatcgacgttgatggttct
gataatgacagtgatgtcgatatcaataaaattaaccaaatgccaggtagcaataatgta
actgctggcagtggtaatttatcaaatgatgcggaactagattcggctacgagaacacgt
aaggaattagaagacaaactagataaacttttgaagaaaccaaaagtaagaagatctaga
caagatgaagatgatttagaacagtatttagatgaaaaaatcttaaggttaaaagatgaa
atgaatattgctgcacagatggatattgaaacattgaataaaagaattgaaaccaatgat
aagagtttaattgctgtacaaaaagttaaactattaccaaaagttgttagcattctatca
aaagctaatttggctgatactattttggataataatttattacaaagtgtgagaatatgg
ctggaaccactacctgatggatctctaccatcctttgaaattcaaaagtctttatttgct
gcattgaataaattaccaattaagactgaacatttgaaggaaagtggtcttggtagagtt
gtaatcttttatacaaaatcaaaacgtgttgaagcaccattacctagaatagcagaaaaa
ctaatagcagaatggacgagaccaatcattggtgcatctgataactatagagataagaga
attttaaaattagagtttgatgcagaaaagttaagaaagaaatcagctttagacaatgct
aaaaatagaaagaagcagaagaatggtagtgaagaaccacgctctagaagtgaaggttcc
tcagcccaatcattatatgaagatgctgctgctaggagaggtagagctgctgccccagct
caaaccacgacagattataaatatgctcctgtaagtaatgctggtgcgttatctagtaat
ttaagatcaaatggtgtcggttcttcattaaataatagcgaaacatacaaaagattgatt
tccagattaaataaatctaagaaatcaaaataa

DBGET integrated database retrieval system