KEGG   Tetrapisispora phaffii: TPHA_0D04010Help
Entry
TPHA_0D04010      CDS       T02235                                 

Gene name
TPHA0D04010
Definition
(RefSeq) hypothetical protein
  KO
K02365  separase [EC:3.4.22.49]
Organism
tpf  Tetrapisispora phaffii
Pathway
tpf04111  Cell cycle - yeast
tpf04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:tpf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    TPHA_0D04010 (TPHA0D04010)
   04113 Meiosis - yeast
    TPHA_0D04010 (TPHA0D04010)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tpf01002]
    TPHA_0D04010 (TPHA0D04010)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tpf03036]
    TPHA_0D04010 (TPHA0D04010)
Enzymes [BR:tpf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     TPHA_0D04010 (TPHA0D04010)
Peptidases [BR:tpf01002]
 Cysteine Peptidases
  Family C50: separase family
   TPHA_0D04010 (TPHA0D04010)
Chromosome and associated proteins [BR:tpf03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    TPHA_0D04010 (TPHA0D04010)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C50
Motif
Other DBs
NCBI-GeneID: 11534286
NCBI-ProteinID: XP_003685469
UniProt: G8BT64
Position
4:complement(844516..849387)
Genome map
AA seq 1623 aa AA seqDB search
MQDDPLMEMNVNSTPNLNMENTFHKNGENILRTTTCVTQTNISYNDIEAQISRINVINQN
FNASIQKYYDICLKFHNYQIKKVLIKKHLSCIVKLINSNNFDRANVEILELYNTNNRQDQ
INNTRDILFVDFTVLNENYLQIIKILILQILLKTKKSFNEIESERIVKLFMDDKRYMICS
KTVDDSASRSKPTLSGIKIYHTLMKVILNFYNVLSPYKLLFGLKFLEYLKAYDLKFENYI
TNISLAAFSNQLRCSVVNDNISKYLNSYYIQYSEYNNNIDKIMISDILHETQLQKNDLNI
QNRAFIELKCVSNTQLSIIFKYFQSVLLNKSIEKTEINNVINQLDSIWRLIRLETFANNA
KLIMKLFDLTIQFINLNVKNISSVNILETLLNSLTEYTIIARNFKRLSNIIAVTYNCYMS
LSYEIFLIKAAKLEIRRYILENNINSCSSFLAKFSKFIMSTKDTKLRLELFQFLFNIDNL
LENHTFTTILNFCKLTYIHCFSKMRLNDFLHFKNCSEVMLAVLYAYSSIRIPPNETWSNI
TNLLYYCISGILNAPSDAMSKFINIHTPKSHALYKAELLIKSAYVLNLELSKHSTANLGT
LTRSFIDKWMIKRVQSVSKEKISAFEYDFVKLLLNYLTYNNFDPLTVELALLIKKHNYYA
NLHLQANYSLLHSFTNLRMLEEIKLLNIEISTISMDFKNNSIDKILNYLNVKLQLQSQLN
EKNEFEELFGKLLPATRPELFDINNSYNIPAPSYIKVLLFNIKLYNTASILQMNHNNVKE
AIIEGKRSLKLAVSLIRKSKILTENCRLELINLVSITYINLVNQYTKIGISRDSQFYITE
FSHLLSQLGNPSVIYKSLNFLHEYYSLSEQPDLADTVLQKANAAFEYIDGRYDINSLTSF
LYRNKETSRVLESLELFFTNKLLNGKYLTIYWNLKLQNVTIDSVDLYYPDLIILNSINQF
RASFLKVQKLMDRDPFFKSIFDSVTSLPSCTFPKKEIPTSLNNGVSLKSSISSGICDSPR
SSNMTPKGKSMKQNFDRAVAIDTLLKSIEFVDNLDLSALSVHDLADIHSFYSLGTMLISN
IQLQNTLTKYEKKCFALADLSKTMPMQHEKDLAQIESNIYDSFSPMQITCNANIVENKIN
ELIDYQKFIQSCSDVFNVISIDICPLTNHLLLSKIDSSSNKTIHVRLPLNRINSRELDTQ
CYTFQDASDELNSIIKASNRSTSLEVTSNVSTKEEKKQWWKSRYDLDKRMEGLITKIDNS
WFSGFSSFFDPCPVNKQYFTEFQSKFYEILHDNLPTRKQYGNPKLFIKLEEWILELFIKL
DTSNESFLNMLEDLIYFVLDILLFHGEENAYDELDINMIFVQLEEEIKKYQSHQAKGDFE
RSHTFLIISSVCHNFPFENLSFLEKRSVSRVPSFSNLITLIKNNNHKIFDKRYIDTNISM
VLNPNGDLIQTEERFKTQFSDIEATVPNSRFLCNDKPNEETFLQMLRTSNLFVYVGHGSG
EQFVRAREIMKLDMISPSFLLGCSSASIKYFGKLEPTSTIIAYLVGNCPMVIGNLWDVTD
KDIDLFSRKLFSNIKFIEDVEFGERKGAQRISLALSDARKVCYLRYLNGAAPVLYGLPIH
FNK
NT seq 4872 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatgatcctttgatggagatgaatgtcaattcaaccccgaatttaaatatggaa
aatactttccataagaatggggaaaacatattaaggacaacaacatgcgtaactcaaaca
aatatctcatataatgatatagaggctcaaatatctcgcataaatgtaattaatcagaat
tttaacgcatcgatccaaaaatactatgatatctgcttgaaattccacaattaccagatc
aaaaaagtattaattaaaaaacatttaagttgcattgttaaattaataaattcaaataac
ttcgatagagccaatgttgaaatactggaactatacaatacaaataatagacaagatcaa
attaataatacacgggatatactctttgtagatttcactgttttgaatgaaaattatttg
caaattattaaaatattgatactacagatattgttgaaaacaaaaaaatcatttaatgag
atagaatcagaaagaattgttaaactatttatggatgacaagaggtatatgatatgtagt
aaaactgtagatgatagtgcgtctcgttccaaacctactctatctggaatcaaaatatat
cacacattaatgaaagttattttaaacttttacaacgtactatccccttataaattattg
tttggattgaaatttttggaatacttaaaggcttatgatctgaagtttgaaaattacatt
actaacatttccctcgccgcattttccaatcaattgagatgttcagtcgttaatgataat
atctcgaaatacttaaattcatattatattcaatattcagagtacaacaataatatagat
aagataatgatttctgatattttacatgaaacacaattacaaaaaaatgacttaaatata
caaaaccgtgcatttattgagttgaagtgtgtatctaacactcaactgtcaattatattt
aagtatttccagtcagttttactaaataagagcattgaaaaaactgaaattaataatgtc
ataaaccagttagattcgatatggagactaattcgattagagacattcgctaataatgca
aaactcattatgaaattgtttgatctcacaatacaatttatcaatttaaatgtgaaaaac
atttcatcggtgaatattttagaaactctactaaattctttaactgaatatactatcatt
gcaaggaatttcaagagactttctaatatcattgcagttacatataactgttatatgtct
ctatcatatgaaatatttttgattaaggcagcaaagctggaaattaggagatacatatta
gagaacaacattaactcatgctctagttttttggctaaattttctaaatttataatgagc
acaaaagatactaagttaagacttgaattatttcaatttttatttaatatcgataatttg
ttggagaaccatacttttactacaattctgaatttttgtaaattaacatatattcactgt
ttctctaaaatgagattgaacgactttttacattttaagaactgctctgaagttatgctt
gctgttctgtatgcatactcatctattagaatacccccaaatgaaacatggtcaaacata
acaaatcttctctactattgcatatctggaattttaaatgcgccctcagatgctatgtcc
aaatttatcaatattcataccccaaaatcccatgcattatacaaagctgaattgttgata
aagagcgcttatgttttgaacctcgaattatctaaacattctactgctaacttaggtacc
ttaacgagaagttttattgataaatggatgataaaacgtgtacaatcagtttctaaagag
aaaatatcagcatttgagtatgattttgtaaaattactactaaattatctgacatacaat
aattttgacccacttacagtagaactggcactgttaattaagaaacataattattacgca
aacctgcatttacaagcaaactattcattattacattcctttactaatttaagaatgcta
gaagagataaaattattgaatattgaaatatcaactattagtatggattttaagaacaat
agtattgataaaatattaaattacttgaatgttaaattgcagcttcaatctcagttaaac
gaaaaaaatgaatttgaagaattatttggaaagctcttaccagcaactcggccagaatta
tttgacattaataattcttacaatattccagcaccatcttatattaaagtgttattgttt
aatatcaagttatacaacacagcatccattttacaaatgaatcataataatgtcaaggaa
gctattattgaagggaaaagaagtttaaaattagctgtttcacttattagaaaatctaaa
attttaacagagaattgtcgtctcgaattaataaatctagtttcgataacatatattaat
ttggttaaccaatataccaagattggaatatcaagggactcgcagttttacattacagaa
ttttcgcacctgctttctcaacttggtaatccttcagtgatttataaatctttgaatttt
ctccatgagtattattctctgtctgaacagcctgatttggctgatacagttctgcagaaa
gcaaatgcagcattcgaatatattgatgggcggtacgatattaattcattaacttcgttt
ttgtaccgaaacaaagaaacatcaagagtattggaatctcttgaattattttttacaaac
aagttattaaacggaaaatacttaaccatttattggaacttgaaattgcaaaatgtgacg
atagattctgttgatttatattatcctgatttgataattttaaattcgattaatcaattt
cgtgcatcatttttgaaagttcaaaaacttatggatagagatccttttttcaaaagtatt
tttgattccgtgacatcacttccatcctgtacctttcctaaaaaagaaattccaacatca
ttaaataatggtgtttccttaaaatcaagcatatcatcaggcatttgtgattctccaaga
tcatcaaatatgactcccaaaggtaaaagtatgaaacaaaatttcgacagagcggttgct
attgatactttattgaagtcaatagaatttgttgataacttagatctttctgctttaagt
gtccatgacttagctgacatccattcattttattcattgggaacaatgctaatatcgaat
attcagcttcaaaatacgttaaccaaatatgaaaaaaaatgctttgcattagctgattta
agtaaaactatgcctatgcaacatgaaaaggatttagctcaaattgagtccaatatctac
gattcctttagtccaatgcagataacatgcaatgctaatattgtcgaaaataaaataaat
gaactaatagactatcaaaagttcattcagtcgtgttcagacgttttcaatgttatatca
attgatatctgtccactaactaatcatttattgttatcaaagatcgattcctcttccaat
aagactattcatgtccgtctacctttaaatagaataaattcaagagaattagacacacaa
tgttacacctttcaggatgcatcagatgagttaaattcaataattaaagcaagcaatcgt
tctacgtcgttggaggtaacaagtaatgtatcgacaaaagaagaaaagaagcaatggtgg
aaaagtagatatgaccttgacaaaagaatggaaggtttaattacaaaaattgataatagt
tggttcagcggattttcatcattttttgatccatgtccagttaataaacagtattttacg
gaatttcagtctaaattttatgaaattcttcatgataatttgcccacaagaaaacaatat
ggaaatcctaaattatttattaaactggaagagtggatattggagttatttatcaaactc
gatacctctaatgagtcttttttgaatatgctggaagaccttatttattttgtcttggat
atactactattccatggtgaagaaaatgcatatgatgaattagatattaatatgatattt
gttcaactagaagaagagatcaaaaagtaccaatcacaccaagcaaaaggagattttgaa
cgtagtcacaccttcctgattatttcaagtgtatgtcacaattttccatttgaaaaccta
tcttttctggaaaagagatctgtttctcgagtaccttctttttctaatttgataacatta
attaaaaacaataaccacaaaatatttgataagagatatatcgatactaatatatctatg
gtcctgaatccaaatggtgacttgatacaaactgaagagagatttaaaactcaattctct
gatattgaagcaaccgttccaaattctagattcctttgcaatgacaagcctaacgaagaa
acattccttcagatgcttagaacttctaatttatttgtgtatgttggacatggtagcggc
gaacagtttgtacgggctagagaaatcatgaaactcgacatgatatctcctagtttttta
cttggttgttcatctgcgtccataaagtatttcggaaaattagagccaacaagtactatt
atcgcttatttagttgggaattgccccatggttattgggaatctatgggatgtgacagac
aaagatatagatttgttcagcagaaaattattctcaaatataaaatttatcgaagatgtt
gaatttggtgagcgaaaaggagctcagcgtatttcacttgcattaagtgacgcaagaaaa
gtttgttatctcaggtatctaaatggagccgcaccagtattatatgggttaccgattcat
ttcaataaatag

DBGET integrated database retrieval system