KEGG   Tetrapisispora phaffii: TPHA_0E00740Help
Entry
TPHA_0E00740      CDS       T02235                                 

Gene name
TPHA0E00740
Definition
(RefSeq) hypothetical protein
  KO
K03350  anaphase-promoting complex subunit 3
Organism
tpf  Tetrapisispora phaffii
Pathway
tpf04111  Cell cycle - yeast
tpf04113  Meiosis - yeast
tpf04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    TPHA_0E00740 (TPHA0E00740)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    TPHA_0E00740 (TPHA0E00740)
   04113 Meiosis - yeast
    TPHA_0E00740 (TPHA0E00740)
Protein phosphatases and associated proteins [BR:tpf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     TPHA_0E00740 (TPHA0E00740)
Ubiquitin system [BR:tpf04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     TPHA_0E00740 (TPHA0E00740)
Chromosome and associated proteins [BR:tpf03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    TPHA_0E00740 (TPHA0E00740)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_2 TPR_1 TPR_8 ANAPC3 TPR_17 TPR_11 TPR_14 TPR_16 TPR_12 TPR_19 TPR_9 TPR_6 TPR_15 SRP_TPR_like DUF3856 TPR_21
Motif
Other DBs
NCBI-GeneID: 11531377
NCBI-ProteinID: XP_003685603
UniProt: G8BTE1
Position
5:complement(142456..144696)
Genome map
AA seq 746 aa AA seqDB search
MLFGTGPSLHKYNNLLNGNNDDIINENTLNNIINLNEYIQQSILQLNYDSAEFLSELLFA
ECKKLNDRTIYKIEAIYLYSLSLYLNENIHTAFDISKNYKHLNIGIAYVYALCSNKLNNK
NINDSIRILLDFKEKINSNNSTTTTLPASNLIHFPNTATIDCLLGKLFKKNDNLKESAVY
FTEALNKNPYLWEAYVELSNSRATLDLQKLYSVLIKHSQANQQQQQYNSSNILHHTHHPN
RNRFNSVVKPYSTPFKSNRNNNYIINSSLKINDHPKQSLLGSNKKTITSGSILNKTNVMA
STTSSNSNNNNSNNNTTSERQSSHFKVLNKNKFFSSSPSKKVLNDTSTLKTPKGKTTSTQ
HSNISNSNSKNNAGILNKDQASTTNSFASSDSPNSSLLLSSTKNNRSGQNSQQQQPLSIS
LVEIMYSFAKIMKTSSLYDSYKAIRLLNNDIPQHIRENMPWCQAQLGKLHYELVNYEVSL
QYFLNLKTLQPSRVKDLEIYSTLLWHLNDKSKLSILSSELITSNPRIPETWCCLGNFLSL
QKNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRCYRKAIACDPGHYNAYY
GLGMVSMKLGQYEEALLFFEKARSINPINVVLVCCGGVALEKLSYQEKALQYYELACELQ
PSSSLATFKRAHLLYSMGRYTLALKFFEELKHVAPDEATVHFLLGQIYSILGRKKDAIKE
YTIALNLDPKGRQLIMEALEKCHTLD
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgttatttggaactggcccaagtttacataaatataacaatctactcaatggtaataat
gacgatataattaacgagaacactttgaataatataataaatttaaacgaatacatacag
cagtccattttacaattgaattatgacagtgcagaatttctatcagagttattatttgca
gaatgtaaaaaattaaatgacagaactatctataaaattgaagcaatttatctttattct
ttatcactttatttgaatgaaaatatacatactgcatttgatatttctaaaaactataaa
catttaaatattggtattgcatatgtttatgctttgtgttcgaataaattaaataataaa
aatatcaatgattcaattagaatattgttagattttaaagaaaaaataaattcaaataac
tcaacaacaacaactttaccagcatccaatttgatacatttcccaaatactgcaacaata
gattgtctattaggaaaattatttaaaaaaaatgataatctaaaagaaagtgcagtttat
tttacagaagcgttaaataagaacccgtatttatgggaagcttatgtagaattatcaaat
tcaagggcaacccttgatttacaaaaattatactcagttttaattaaacattctcaagca
aatcaacaacaacaacagtataattcatcaaatatattgcatcatacgcatcatccaaat
agaaatagatttaattcagtggtgaaaccatattcaacaccattcaaatctaataggaat
aacaactatataataaattcttcattaaagataaatgatcatccaaaacaaagtttgttg
ggttcaaataaaaaaactataacatcaggatcaatactaaataaaactaatgtaatggca
tccacaacttccagtaatagcaataacaacaacagcaacaataatactacgtctgaaagg
caaagtagtcattttaaggttttaaataaaaataaattcttctcaagttctccaagtaaa
aaagtcctcaatgatacttcaacattaaagacacccaagggcaagacaacaagtactcaa
catagcaacatttcaaactcaaattcaaaaaataatgctggcattttaaataaagatcaa
gccagcactacaaactcatttgcatcatcagattcaccaaactcatctcttttattgtct
tcaaccaaaaataatagaagtggtcaaaattcccaacaacaacaacctttatcaataagc
ttggtcgaaattatgtattctttcgcaaaaataatgaaaacgtcatcattatatgattcc
tataaagccatccggttactaaacaatgatataccacagcatattagggaaaatatgcct
tggtgccaagctcaactaggtaaattacattacgagttggtcaattacgaggtctcctta
caatattttctgaatctaaagactctgcaaccatcaagagtaaaggacttagaaatatat
tcaactttgctatggcatttaaatgataagtcaaaactaagtatactatcaagtgagtta
attactagtaacccaaggataccggagacttggtgttgtttaggtaatttcttatcttta
caaaaaaaccatcatgaagcaattaaagcctttgagaaggctacacaggtagatcctaaa
tttgcatatgcatacacactacaaggtcatgaatatacttcgagcgattcattcgatgtt
gccaaacgttgctatagaaaagctattgcatgtgatccaggtcattataatgcatattat
ggtcttggtatggtttcgatgaagctaggccaatacgaagaagctctcttattctttgaa
aaagctcgttcaattaaccctattaatgttgtgttagtatgctgcggtggtgtagcacta
gaaaagttaagctaccaagagaaagcgctccaatattatgaactggcttgtgaactacaa
ccatcctcttctcttgcaacattcaagagagcccatttattgtattccatgggaagatac
actttagcattgaaattttttgaagaattgaaacatgttgctccggatgaagcaacagtt
catttcttattaggacaaatatattcgatattaggaagaaaaaaggatgcaattaaggaa
tatactattgcattaaacttggacccaaaaggaagacaattaataatggaagccttggag
aaatgtcacacattggattaa

DBGET integrated database retrieval system