KEGG   Tetrapisispora phaffii: TPHA_0F01860Help
Entry
TPHA_0F01860      CDS       T02235                                 

Gene name
TPHA0F01860
Definition
(RefSeq) hypothetical protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
tpf  Tetrapisispora phaffii
Pathway
tpf00620  Pyruvate metabolism
tpf00630  Glyoxylate and dicarboxylate metabolism
tpf01100  Metabolic pathways
tpf01110  Biosynthesis of secondary metabolites
tpf01200  Carbon metabolism
Module
tpf_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TPHA_0F01860 (TPHA0F01860)
   00630 Glyoxylate and dicarboxylate metabolism
    TPHA_0F01860 (TPHA0F01860)
Enzymes [BR:tpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TPHA_0F01860 (TPHA0F01860)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-GeneID: 11535525
NCBI-ProteinID: XP_003686102
UniProt: G8BV86
Position
6:complement(425114..426787)
Genome map
AA seq 557 aa AA seqDB search
MVRVSLNNVKLLVDIDNKPQFHPSTTTVQTILTAECLEFIVLLHRTFNSKRKLLLSNRQL
LQKKLDSGLYQLDFLEETEYIRDDPTWKGPKSLGPGLIDRSVEITGPPLRNMLINALNAE
FVNTYMVDFEDSLSPTWQNIIYGQVNLYDLIRDNINFTSVNGKNYSLKDKIQNLPTLIVR
PRGWHMVEKHLYIDDEPISASIFDFGVFFYHNAQALIDLGKGPYFYLPKMEHHLEAKLWN
DIFNVAQDYLSIPRGTIRATVLIETLPAAFQMEEIIYQLRDHSSGLNCGRWDYIFSTIKR
LRNLPTHVLPNRDLVTMTSPFMDSYVKRLINTCHRRNVHAMGGMAAQIPIKDDKTRNDAA
MQKVRTDKIRELTNGHDGSWVAHPALAPICHEVFVNMGTKNQIHYIPDTKITSADLTNTS
IQDFQVTTEGIKQNLDIGLRYMEAWLRGSGCVPINYLMEDAATAEVSRCQLYQWVKHGVT
LSDTGEVVTPELTTKILTEQVSRLKQSSPVGDKNKFDTAAKYFLPEITAKHFSEFLTTLL
YDEIVTQKSAPTHLSKL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggtaagagtatctttaaataacgttaaattattagtggacattgataataaaccacag
tttcacccttcaactactactgtgcagactattttaactgcagaatgtttggagttcatt
gtcctattacatagaacttttaattccaagagaaaattactattgtcaaatagacagcta
ttacaaaaaaaattggactcaggtctttatcaattagattttttagaggaaacagagtat
attagagatgatccaacttggaaaggtccgaaatctttaggtccaggcttgatagataga
tccgttgaaattactggtcctccattaagaaatatgttaattaacgctttgaatgcagaa
tttgttaatacttatatggtagattttgaagattcattatcaccaacttggcagaatatc
atttatggacaagtaaacttgtatgatttaattagagataatattaattttacttctgtt
aatggaaaaaattatagtttgaaagataaaattcaaaatttaccaacattaatagtgaga
ccaagaggttggcatatggttgaaaaacatctatacatcgatgatgaaccaatctctgct
tcaatcttcgactttggtgttttcttctatcacaatgcacaggctttgattgacttgggg
aaaggtccatatttctatttaccaaaaatggaacatcatttggaggcaaaattatggaat
gacatctttaatgtcgcacaggattatttatctattccaagaggaacaatcagagccact
gtattgatcgaaactttacctgcagctttccaaatggaagaaataatttatcaattaaga
gatcattcctcaggattgaattgtggtcgttgggactatatattctcaacaataaaaagg
ttacgaaacttacctactcatgttttacctaatagagatttagtgacaatgacctctcca
ttcatggattcgtatgttaaaaggttgatcaatacatgccacagacgtaatgttcatgca
atggggggtatggctgctcagattccaattaaggatgacaaaacaagaaatgacgcagca
atgcaaaaagttagaactgataaaatcagagaattgactaatggacatgacggctcatgg
gtagcacatccggctttggcaccgatctgtcatgaagtgtttgtaaacatgggaactaaa
aaccaaattcattacattccagatacaaagatcacctcagcagatttaacaaacacaagt
atccaagattttcaagtaacaactgaaggtatcaaacaaaaccttgatattgggttaaga
tacatggaggcttggctaagaggttctggctgtgtcccaattaactatttaatggaagat
gcagcaacagcagaagtctcacgttgccaattataccaatgggttaagcacggtgttact
ttaagtgacacgggtgaagtcgttacccccgaattaacaacaaagattttaacggagcag
gttagtagattgaaacaatctagtccagttggtgacaaaaataagtttgacacagctgca
aaatacttcttacctgaaataacagctaaacatttcagtgagtttttaaccactttgtta
tatgatgagatcgtaacgcaaaaatcagctccaacccatttaagtaaattataa

DBGET integrated database retrieval system