KEGG   Tetrapisispora phaffii: TPHA_0F03410Help
Entry
TPHA_0F03410      CDS       T02235                                 

Gene name
TPHA0F03410
Definition
(RefSeq) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
tpf  Tetrapisispora phaffii
Pathway
tpf00260  Glycine, serine and threonine metabolism
tpf01100  Metabolic pathways
tpf01110  Biosynthesis of secondary metabolites
tpf01130  Biosynthesis of antibiotics
tpf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TPHA_0F03410 (TPHA0F03410)
Enzymes [BR:tpf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     TPHA_0F03410 (TPHA0F03410)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 11535446
NCBI-ProteinID: XP_003686255
UniProt: G8BUN5
Position
6:733567..734733
Genome map
AA seq 388 aa AA seqDB search
MSEFELPPNYVSASNDFRSDTFTTPTSEMIQVALSATKGDAVYGEDTDTVLLEKTIAKTF
GYDAGLFCVSGTLSNQIALRTHLTQPPYSILCDYRAHVYTHEAAGLAILSQSMVVPVIPS
NGNYLTLEDIQSHYIPDDGDIHGAPTRVISLENTLHGILYPLEELFRIRTWCKANNLLLH
CDGARIFNACAESGVPSKQFAEIFDSISVCLSKSVGAPIGSVLVGDVKFIKKANHFRKQQ
GGGIRQSGMISRMALYCVDGDWKEKIRYSHSLAHNLAAFCKQEGIPLESPADTNFVFIDL
QKAKMDPDVLVKKGLKYGVKLMGGRVSFHYQISNESLEKVKLAVKESFEYAKTHPYSQNG
PTQIYRSESTEKMDVDGNAIRDIKTYKY
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagttcgaattaccaccaaattacgtctctgcctccaatgatttccgttccgat
accttcaccactccaactagtgaaatgatccaagtggctttatctgccacgaaaggtgat
gccgtttacggtgaagacactgatactgttttattggaaaagactatcgctaaaacgttc
ggttacgatgccggtttgttctgtgtttctggtactttatccaaccagatcgctttgaga
actcatttgacccaacctccatattccatcctttgtgattacagagcccatgtatacact
cacgaagctgctggtttggctatcctatcccagtcaatggttgtcccagttattccttca
aacggtaactacctgacgttggaagacatccaatctcattacatcccagatgatggtgat
atccatggtgctccaactagagttatttctctagaaaatactttacacggtatcttatat
ccattggaggaattattccgtatcagaacctggtgtaaggctaacaatttattattacac
tgtgatggtgctagaattttcaatgcttgtgctgaatctggtgtaccatccaaacaattt
gctgaaatctttgactctatatctgtctgtttgtcaaagtccgttggtgctccaatcggt
tctgtcttagtaggtgacgtaaaattcatcaagaaggctaaccatttcagaaaacaacag
ggtggtggtatcagacaatctggtatgatctcgagaatggctctttactgtgttgacggt
gactggaaagaaaaaatcagatactctcactctttggctcacaacttagccgctttctgc
aaacaagaaggtattccattagaatccccagctgatactaacttcgttttcattgactta
caaaaagcaaagatggaccctgatgttttagtcaagaaaggtctaaaatacggtgtcaag
ctaatgggaggtagagtctctttccactaccaaatttctaacgaatcattagaaaaagtc
aagctagcagttaaagaatctttcgagtatgccaaaactcatccatacagtcaaaatggt
ccaactcaaatttatagaagtgaatctactgaaaagatggatgtcgatggtaatgctatc
cgtgacattaaaacttacaaatactag

DBGET integrated database retrieval system