KEGG   Tetrapisispora phaffii: TPHA_0I01570Help
Entry
TPHA_0I01570      CDS       T02235                                 

Gene name
TPHA0I01570
Definition
(RefSeq) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
tpf  Tetrapisispora phaffii
Pathway
tpf00220  Arginine biosynthesis
tpf00330  Arginine and proline metabolism
tpf01100  Metabolic pathways
tpf01110  Biosynthesis of secondary metabolites
tpf01130  Biosynthesis of antibiotics
tpf01230  Biosynthesis of amino acids
Module
tpf_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    TPHA_0I01570 (TPHA0I01570)
   00330 Arginine and proline metabolism
    TPHA_0I01570 (TPHA0I01570)
Enzymes [BR:tpf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     TPHA_0I01570 (TPHA0I01570)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 11534506
NCBI-ProteinID: XP_003687097
UniProt: G8BXN5
Position
9:357184..358161
Genome map
AA seq 325 aa AA seqDB search
MTFDMLEKQETPHYNFIKGHALTVIKAPFSDGQSKKGVEKGPDYLLKQGLVHDLENLGWT
TEIVNPLAEVTGSVQNVTTYKNIHNIDSVACSTELIYKTVRDTTKDGRFALTLGGDHSIA
IGTILGALKTYPDLGLLWIDAHADINTLDTTESGNIHGCPVAFAMGLNEVVPAPFSWLNS
LRKLKKNRIAYIGLRDIDEGEKQVLKENNITSVFTMYHIDRYGMNNVIEMALKALNKDGD
SPILCSYDVDSVDPLYVPATGTPVRGGLTLREGLFLAERLAETGNLVGLDIVECNPDLAT
NDIHVVDTISAGCAVARCALGETLF
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcgatatgttagaaaaacaagaaaccccacactataattttattaagggccat
gctttgacagttatcaaggctccattctcagatggtcagtcaaagaaaggtgttgaaaaa
ggcccagactatcttttgaagcaaggtttagtgcacgatctagagaatttaggttggact
accgaaattgtcaacccattagctgaggtaactggaagtgttcagaatgttacaacttat
aagaatatccacaacatagattctgttgcttgttctacggaacttatttacaaaactgtc
cgggatactacaaaggatggtcggtttgccttgactttgggtggtgatcattccattgct
attggtactatattaggtgcattgaaaacctatccagatctgggtttactttggatcgat
gcacatgccgatattaatactttggatacaactgaatcgggcaatattcatggatgccct
gttgcttttgcaatgggtttgaatgaagttgttcctgctcctttctcttggttaaattca
ttaagaaaattaaagaaaaacagaattgcatatattggcttaagagatattgatgaaggt
gaaaagcaggtcttaaaagaaaataatattacgtcagtattcacaatgtatcacatcgat
agatacggcatgaataacgtcatcgaaatggcattgaaggctcttaataaagatggagat
tctcccattctatgttcttatgatgtcgattctgtggatccattgtatgtacctgctacc
ggtacaccagtaagaggtgggctcaccttgagagaaggtttgttcttagccgaacggtta
gcagaaactggtaacttagtaggtttagatatagtcgaatgtaatccagatttggccaca
aatgatatccacgttgtagacactatttcggcaggctgtgctgttgcaaggtgtgcatta
ggtgaaacattattttaa

DBGET integrated database retrieval system