KEGG   Tetrapisispora phaffii: TPHA_0J00210Help
Entry
TPHA_0J00210      CDS       T02235                                 

Gene name
TPHA0J00210
Definition
(RefSeq) hypothetical protein
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
tpf  Tetrapisispora phaffii
Pathway
tpf00562  Inositol phosphate metabolism
tpf01100  Metabolic pathways
tpf04070  Phosphatidylinositol signaling system
tpf04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    TPHA_0J00210 (TPHA0J00210)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    TPHA_0J00210 (TPHA0J00210)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    TPHA_0J00210 (TPHA0J00210)
Enzymes [BR:tpf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     TPHA_0J00210 (TPHA0J00210)
Membrane trafficking [BR:tpf04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    TPHA_0J00210 (TPHA0J00210)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    TPHA_0J00210 (TPHA0J00210)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y C2 EF-hand_7 EF-hand_1 EF-hand_like EF-hand_5 EF-hand_6 EF-hand_4
Motif
Other DBs
NCBI-GeneID: 11533031
NCBI-ProteinID: XP_003687279
UniProt: G8BYA3
Position
10:complement(48745..51402)
Genome map
AA seq 885 aa AA seqDB search
MVVKFQNVQNENLDDMLGDFRNGEDETIYEGENMDIDNISGSCLGYSDTNVSSVGTSNIS
LTTLSKGLRNLARKTSDIVLLNNNNDDQSYVGPLTTPRAISIAFQYEPSNLLISNELSIE
CEKFRNGIPMMKITRNKSKMRTLRLNGLESITWKDGKKKMDIDTIKDIRIGNLARNYREE
YEISNEFAKFWITVIYEVSNKLKALHVIANNSEDFNTVYACIRGLVKHRSEFMESMALPG
NEKFAKVHWHSTVSFKREDEEVDVLSFEDVEKLCLKFHIYFPSSHLLKVFKAADLNNNGL
LNFQEFQIFVKLLKKREEIDKLWKSITKDDGQYLDLRRFKHFLLNIQKENFTEEYINLLY
SKLCNPTVTKITKANFLKYLSTAPYLKEIEEDYSKPINHYFIASSHNTYLLGKQYGETPS
VEGYIQALQHGCRCVEIDIWDDESGPVVCHGFLTSAIPLINVVNVIRKYAFITSPYPLII
SLEVNCNNQNQIKVASIFNEILGDSLVYENEFELGLLSPEKLKHKIIVKVKKTKNIQDIK
DASTIEASNSHAGSFYDTDESLYEVERDTSSMQSSESMVSQSSSSSIKTRIKRLKMIRET
EIHKELLGICGIHGLKFRNLSLPESKSLTHCFSFNEKKYLNLCTDESLKLSFNKHNRKYL
TRVYPHAFRYKSSNFNPVFFWESGVQMVATNWQTNDYGQQLNKAFFQLSDEKNSQLHSGY
KLKPPHLISIVSKTMEISHIPNDYKPKPLHIKLDIVSAQLLHKPKELYSKDVVLSPYVVV
EFICEENCIDSLTSRNATILAKNKAQTNSCKGNGFNPIWESRLNALLHNSYFAFIKFTVK
TSSVVLAECCLKLDTVKQGYRHIPLYNTKGEKFIFSTLFIRLYTT
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atggtagtgaagttccagaacgtgcaaaatgaaaacttagatgatatgctaggggacttc
aggaatggtgaagatgagacgatatatgaaggtgagaacatggatattgataatattagt
ggaagttgcctaggttactcggatacaaatgtctccagcgttggaacatccaatatatcg
ctcaccaccttgtcgaaaggattacgaaacttggctagaaagacatcagatatcgttttg
ttgaataataataacgatgatcaatcgtatgtgggtcccttgactactcctagggcgatc
agcatagctttccaatacgaaccaagcaatttgttgatctcaaacgaattgagcattgaa
tgtgagaagtttcgcaatggtattccaatgatgaagataactcgtaacaaaagtaaaatg
aggactctgagattaaatggactagaatcgattacttggaaagatggtaagaagaaaatg
gacatagatacgatcaaagatattcgaattggtaacttggcaagaaactatagagaagag
tatgaaatatcaaatgaatttgcaaaattttggattaccgtgatatatgaagtttcaaac
aaactgaaagctcttcatgttatagcaaataactcagaagatttcaatacagtttatgcg
tgtattcgtggactagtgaaacataggtccgaattcatggaaagtatggcgcttcctggt
aacgagaagtttgctaaagttcattggcactcaaccgtatcattcaaaagagaagatgag
gaagtggatgtactatcttttgaagatgtggaaaaactatgtctaaagtttcatatttat
tttccttccagtcatttattgaaagtctttaaagctgctgatttaaataataatggtcta
ttaaatttccaagaatttcaaatattcgttaaattattaaagaaaagagaagaaattgat
aaactatggaaatctattacaaaggatgatggacagtaccttgatcttcggcgatttaaa
cattttctattaaatattcaaaaagaaaattttactgaggaatatatcaacttactatat
tctaagttgtgtaatcctacagttactaaaattacaaaagcaaatttccttaaatatctg
tcaactgcgccatatttaaaggaaattgaggaagattactcgaagccaataaatcattac
tttattgcttcttcgcataatacatatctgttaggtaagcaatatggtgaaacaccatcg
gtggaaggatacatacaagcactgcagcatggatgtaggtgtgtagaaattgatatttgg
gatgacgagtctggacctgttgtctgtcatgggtttttaacatctgctattccattgatt
aacgttgtaaacgtaatcagaaaatatgcgttcattacctccccatatccgctaataatt
tcacttgaggttaattgtaacaatcaaaatcaaataaaagttgcttctatcttcaatgaa
attttaggtgatagtttagtttatgaaaatgaatttgaacttggtttactttcgccagaa
aaactgaaacataaaatcattgtaaaagttaaaaaaactaaaaatatacaagatatcaaa
gatgcttctacgattgaggcatctaattcgcatgcaggatcattttacgatacagatgaa
tctctttatgaagtcgaacgcgatactagttcaatgcaatcttcagaaagtatggtgtca
cagtcgagctcatctagtataaagacaagaatcaagagactgaaaatgattcgagagacc
gaaattcataaagagctgcttggtatttgtggaatacatggcttaaaatttagaaattta
tctcttccagaatctaaatcattaactcactgcttctcttttaacgaaaagaagtattta
aacctatgcacagatgaatctcttaaattatcttttaataagcataataggaaatattta
actcgggtgtatccacatgcctttagatacaaatcgtcgaattttaaccctgtatttttc
tgggagtctggtgttcaaatggtagctactaattggcaaaccaatgactatgggcaacaa
ttgaataaagctttctttcaactttcagatgaaaaaaactcgcaattgcattcaggatat
aagttaaaaccaccccatttgatatctatagtctctaagacaatggagatatcacatatc
cctaatgattataaaccaaaacctttgcacattaagttagatatagtatcagcacaactt
cttcataaaccaaaggaactgtattcaaaagatgttgttctatcgccatacgtggttgtt
gaatttatttgcgaagagaattgcattgattcattaacctctagaaatgctacaattttg
gccaaaaataaagctcagacaaactcctgtaaaggtaatggatttaacccaatttgggag
tctcgtttaaatgcattactgcacaacagttatttcgcatttattaaattcacagtgaaa
acaagttcagtagtacttgctgagtgttgtttaaaacttgacacagtgaaacaaggatac
aggcatatcccattatataatactaaaggtgaaaaatttatcttctcaacattatttatt
cgtttatatacaacctaa

DBGET integrated database retrieval system