KEGG   Tetrapisispora phaffii: TPHA_0M00730Help
Entry
TPHA_0M00730      CDS       T02235                                 

Gene name
TPHA0M00730
Definition
(RefSeq) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tpf  Tetrapisispora phaffii
Pathway
tpf00010  Glycolysis / Gluconeogenesis
tpf00071  Fatty acid degradation
tpf00350  Tyrosine metabolism
tpf01100  Metabolic pathways
tpf01110  Biosynthesis of secondary metabolites
tpf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TPHA_0M00730 (TPHA0M00730)
  Lipid metabolism
   00071 Fatty acid degradation
    TPHA_0M00730 (TPHA0M00730)
  Amino acid metabolism
   00350 Tyrosine metabolism
    TPHA_0M00730 (TPHA0M00730)
Enzymes [BR:tpf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TPHA_0M00730 (TPHA0M00730)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 11531893
NCBI-ProteinID: XP_003688082
UniProt: G8C0D3
Position
13:complement(137798..138850)
Genome map
AA seq 350 aa AA seqDB search
MSTEIPKTQKGVIFYENNGPLEYKDIPVPTPLPNELLIHVLYSGVCHTDLHAWHGDWPLP
VKLPLVGGHEGAGVVVGMGSSVKGWKVGDYAGIKWLNGSCMSCEECELSNESNCPEADLS
GYTHDGSFQQYATADAVQAAKIPAGADLKNIAPILCAGVTVYKAIKSANLKAGDWLAISG
ACGGLGSLAIQYGKAMGFRILGIDGGAEKEELFKKLGGEYFIDFTQCKDIIAEVKKATNG
GAHGVINVSVSEAAIEASTNYVRSNGTVVLVGLPAGAVCKSNVFNQVVKSTKIVGSYVGN
RADTREAIDFFVRGLVKSPIKVVGLSQLASVFDDMQAGKIVGRVVVDTSC
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccgaaatcccaaagacccaaaaaggtgttattttctacgaaaacaacggtcca
ttagaatacaaggacatcccagtcccaactccattaccaaatgaacttttgatccatgtc
ttatactccggtgtctgtcacactgacttgcacgcttggcacggtgactggccattgcca
gtcaagttaccattagtcggtggtcacgaaggtgccggtgttgttgtcggtatgggttcc
tccgttaagggctggaaggtcggtgactacgctggtatcaagtggttaaacggctcttgt
atgtcctgtgaagaatgtgaattgtccaacgaatccaactgtccagaagctgacttatcc
ggttacactcacgacggtagtttccaacaatacgccaccgctgacgctgtccaagccgct
aagatcccagctggtgccgacttaaagaacatcgccccaatcttatgtgccggtgttacc
gtctacaaggccatcaagtccgccaacttaaaggctggtgactggttagctatctccggt
gcttgtggtggtttaggttctctagccatccaatacggtaaggctatgggtttcagaatc
ctaggtatcgatggtggtgccgaaaaggaagaattattcaagaagttaggtggtgaatac
ttcattgacttcacccaatgtaaggatattattgctgaagttaagaaggccactaacggt
ggtgctcacggtgtcatcaacgtctccgtctccgaagccgctattgaagcctccactaac
tacgtcagatccaacggtaccgtcgtcttagtcggtttaccagctggtgccgtgtgtaag
tccaacgtcttcaaccaagtcgttaagtccaccaagattgtcggttcttacgtcggtaac
agagctgacaccagagaagctattgacttcttcgtcagaggtttagttaagtccccaatc
aaggttgtcggtctatctcagttagctagtgttttcgacgacatgcaagccggtaaaatt
gtcggtagagttgtcgttgacacttcctgttaa

DBGET integrated database retrieval system