KEGG   Tetrapisispora phaffii: TPHA_0P01120
Entry
TPHA_0P01120      CDS       T02235                                 

Gene name
TPHA0P01120
Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
tpf  Tetrapisispora phaffii
Pathway
tpf00100  Steroid biosynthesis
tpf01100  Metabolic pathways
tpf01110  Biosynthesis of secondary metabolites
Module
tpf_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:tpf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    TPHA_0P01120 (TPHA0P01120)
Enzymes [BR:tpf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     TPHA_0P01120 (TPHA0P01120)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 11530909
NCBI-ProteinID: XP_003688704
UniProt: G8C292
Position
16:227339..228652
AA seq 437 aa
MQSKLNPKTTEFEFGGTIGAIGISVGLPILTILLNQMIRPDYFIEGFFTNFNFADVWNGI
KPISYYLTKADLWTYYLIWYIVLAVFDIILPGRKMQGVELRDGTKLNYKINGVAVSAALI
LVLAFRYQLTDGDLPELQYLYENQVDLCIITILFSVMLSTYCYVASFIPLWGKNGNNTNE
KILALGGNSGNPIYDWFIGRELNPRIGPIDLKMYSELRPGMLLWFLINLSCLHHNYLETA
KINDALVLINCLQGFYIFDGVLNEEGVLTMMDITTDGFGFMLAFGDLTLVPFTYSLQARY
LSVSPIELGTYRVSFIVTVMALGFWVFRAANQQKSDFRQGKLAHLKSIQTKRGTKLLCDG
WWGKSQHMNYFGDWIISLSWCLTTWTQTPLTYYYSAYFMSLLLHRQQRDEQKCRGKYGKD
WEEYEKKVPYKIVPYVY
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgcagtctaaattaaatccaaagacaactgaatttgaatttggtggcaccatcggtgca
attggtatatcagttggtttaccaattttaaccatcctattaaatcaaatgataagacct
gactattttattgaaggtttcttcactaatttcaattttgctgatgtctggaatggtatt
aaaccaatcagctattatttaaccaaggctgatctatggacttactatcttatttggtac
attgttctagcagttttcgatataattttaccaggcagaaaaatgcagggtgttgaatta
agagatggcacaaaattaaactataaaattaatggtgttgctgtatcggcagctttaatt
ttagtattagctttcaggtatcagttaactgatggtgacttgccagaattacaatattta
tatgaaaatcaagttgatttatgtataattacaattttattctctgttatgttatctact
tattgttatgttgcaagttttattccattatggggcaaaaacggtaacaataccaatgaa
aagattttggcactggggggcaattctggtaatccaatatatgattggtttattggtaga
gagttgaatccaagaattggcccaattgatttaaagatgtactccgaattaagaccaggt
atgttactatggtttttaattaacttatcctgtttacatcataactatttggaaactgct
aaaataaacgatgcattagttttgataaactgtctacaaggtttttatatttttgatggt
gtattaaacgaagaaggtgtattgaccatgatggatattactaccgacggttttggcttc
atgttagcttttggtgatttaacattagttcctttcacttattccttacaagccagatat
ctaagtgtatctccaatagaattgggtacttacagagtatcattcattgttacagttatg
gcattaggattctgggtgttccgtgctgctaaccaacagaaatcagactttagacaaggt
aaattagctcatttaaagagcattcaaacgaaacgtggtaccaagctattgtgtgatggt
tggtggggcaagtctcaacatatgaattatttcggggattggatcatctctttaagttgg
tgtttaactacatggacccaaactccactaacttactactactcagcttatttcatgtct
ttgttattacatcgtcaacaaagagatgagcaaaaatgtaggggaaaatatggtaaggat
tgggaagaatatgaaaagaaggttccttataagatcgttccttacgtttattaa

DBGET integrated database retrieval system