KEGG   Treponema primitia: TREPR_1108Help
Entry
TREPR_1108        CDS       T01507                                 

Definition
(GenBank) L-allo-threonine aldolase (L-allo-TA) (L-allo-threonineacetaldehyde-lyase)
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
tpi  Treponema primitia
Pathway
tpi00260  Glycine, serine and threonine metabolism
tpi01100  Metabolic pathways
tpi01110  Biosynthesis of secondary metabolites
tpi01120  Microbial metabolism in diverse environments
tpi01130  Biosynthesis of antibiotics
tpi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TREPR_1108
Enzymes [BR:tpi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     TREPR_1108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AEF84377
UniProt: F5YH96
Position
3206617..3207663
Genome map
AA seq 348 aa AA seqDB search
MIDIRSDTVTGPTEAMRKAMANAEVGDDVYGDDPTVNRLEKMGAEILDKEASLFVPSGTF
GNQLALFTWCPRGTEVILGEECHIIQHEAGAASVIAGVQTRPISAPDGVLRPAALLERLR
KAELHYPATSLICLENAHSLGRAVPVEAMDEVRDLAGQWGLPVHLDGARLFNAAAALKRE
AREIAARADSVMFCLSKGLCAPVGSLLAGKREFVEAARFKRKIMGGGMRQAGILAAAGII
ALEDQAGRLREDHGRARFLEKELAAIPGITLSPGDINMVYFSFPPAEDPKIAGGITEFFL
KQNIRINGPERGIFRFVTHHWIGDAEIKTILEASQEAFGEQFSKKAAP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgatagatattcgcagtgataccgtaaccggccccacagaggccatgcgcaaggccatg
gcaaatgccgaagttggagacgatgtgtatggggacgatcccacggtcaaccggctggaa
aagatgggggcggaaatcctcgacaaagaggcttccctttttgtgccttccgggactttt
ggaaaccagctggccctctttacctggtgcccccggggaaccgaggtgatcctgggggag
gaatgccacatcatccagcatgaggcaggggcggcttcggtgatcgccggggtgcagacc
cggcccattagtgccccggacggggtgttgcggccggcggctcttctggaacggctgcgg
aaggcggagcttcactacccggctacttccctgatctgcctggaaaacgcccactccctg
ggcagggcggttcctgtggaagccatggacgaggtccgcgacctggcgggccagtggggg
cttcccgtccacctggacggcgcccggctctttaatgccgcagccgccctgaagagagaa
gcccgggaaatcgccgcccgggccgactcggtcatgttctgcctttccaaggggctttgt
gcgcctgtgggatccctgctggcgggaaagcgggaatttgtggaagctgcccggttcaag
cggaagatcatgggaggtgggatgcgccaggcgggcatattggcggccgcagggatcatt
gccctggaagatcaggcgggccgactgcgggaggatcatgggcgagcacggttcctggaa
aaggaactggcggccataccgggcattactctgagccccggggatatcaacatggtgtac
ttttcctttccaccggcagaggatccaaaaattgccggggggatcaccgaattttttctc
aaacagaacatacggatcaacgggccggagcgcgggatttttcgctttgtcacccaccac
tggatcggagatgcagaaatcaaaacaatcctggaggcttcccaggaagccttcggggaa
caattttccaaaaaggcggccccatga

DBGET integrated database retrieval system