KEGG   Treponema primitia: TREPR_1323Help
Entry
TREPR_1323        CDS       T01507                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
tpi  Treponema primitia
Pathway
tpi00360  Phenylalanine metabolism
tpi00362  Benzoate degradation
tpi00620  Pyruvate metabolism
tpi00621  Dioxin degradation
tpi00622  Xylene degradation
tpi00650  Butanoate metabolism
tpi01100  Metabolic pathways
tpi01120  Microbial metabolism in diverse environments
tpi01220  Degradation of aromatic compounds
Module
tpi_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:tpi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TREPR_1323
   00650 Butanoate metabolism
    TREPR_1323
  Amino acid metabolism
   00360 Phenylalanine metabolism
    TREPR_1323
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TREPR_1323
   00622 Xylene degradation
    TREPR_1323
   00621 Dioxin degradation
    TREPR_1323
Enzymes [BR:tpi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     TREPR_1323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA F420_oxidored CoA_binding CagZ
Motif
Other DBs
NCBI-ProteinID: AEF83715
UniProt: F5YQW3
Position
complement(2987049..2987915)
Genome map
AA seq 288 aa AA seqDB search
MEKIKVGIIGPGNIGSDLMYKVIKSKHLQMHMMTGIVESEGIKRAAGLGFKTSIKGVDAV
AEDPEIKFVFDATSAKAHIHNSAILKAAGKIAIDMTPAAVGPYVVPCVNLDKLTDEVDFN
MVTCGGQATVPIAHAINRAADAEYVEIVSCISSKSAGPGTRANIDEFTETTSKALRVVGG
ADRSKAIIVLNPADPPLLMTNTVYALVKNPDEKRITESVNDIVREVQSYVPGYRLRLPPV
IEGNKVTVIVEVQGAGDFLPPYSGNLDIINQAAVAVAEKLAVKMLGVK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaataaaggttggaatcatcgggccgggtaatatcggcagcgatttgatgtat
aaggttataaagagcaaacacctgcaaatgcacatgatgaccggcatcgtggaatccgag
ggcattaagcgggctgcgggcctgggctttaagacctccatcaagggtgtggacgccgtg
gcggaggacccggagattaaatttgttttcgatgccaccagcgccaaagcccatatccac
aattcagctattctcaaggccgccgggaagatcgccattgacatgacccccgccgctgtg
ggcccctatgtggtgccctgtgtgaacctggacaaactcaccgacgaggtggacttcaac
atggtcacctgcggcggccaggccacggtgcccatcgcccatgctattaaccgggcggct
gacgcagagtacgtggagatcgtttcctgtatttcctccaaaagcgcaggtcccggcacc
agggcgaacatcgacgaatttaccgaaaccacctccaaggccctacgggtggtaggcgga
gcggatcgcagtaaagctatcattgtgctgaaccctgcggacccgcccctgctgatgacc
aatacggtctatgccctggtgaaaaaccccgacgaaaagcggatcaccgaatcggtgaac
gatattgtccgggaagtgcagagttatgtgccgggataccggctgcggcttcccccggtg
atcgaaggcaataaggtcaccgtaatagtggaggtccagggcgccggggacttcctcccc
ccctattcggggaacctggacattatcaaccaggccgcagtggcggtggcggaaaaactg
gcggtaaaaatgctgggggtaaagtag

DBGET integrated database retrieval system