KEGG   Treponema primitia: TREPR_1324Help
Entry
TREPR_1324        CDS       T01507                                 

Gene name
dmpG
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
tpi  Treponema primitia
Pathway
tpi00360  Phenylalanine metabolism
tpi00362  Benzoate degradation
tpi00621  Dioxin degradation
tpi00622  Xylene degradation
tpi01100  Metabolic pathways
tpi01120  Microbial metabolism in diverse environments
tpi01220  Degradation of aromatic compounds
Module
tpi_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:tpi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    TREPR_1324 (dmpG)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TREPR_1324 (dmpG)
   00622 Xylene degradation
    TREPR_1324 (dmpG)
   00621 Dioxin degradation
    TREPR_1324 (dmpG)
Enzymes [BR:tpi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     TREPR_1324 (dmpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm His_biosynth ThiG DUF3866 ComA
Motif
Other DBs
NCBI-ProteinID: AEF85149
UniProt: F5YQW2
Position
complement(2986040..2987047)
Genome map
AA seq 335 aa AA seqDB search
MANSKINIVDTTLRDGSHAVSHSFTAEQAAAVAAGLDKAGIELIEISHGDGIAGSSINYG
FSKVSELDLIEAAGKVVKKAKLGVLLLPGIGTIEDLKEARERGANAVRVATHVTEADIAV
QHIAWAKQAGMFTVGFLMMTHMASPETIVEQAKIFVDAGADYINLADSSGYMVPKDVRAR
IGALKAAISIPVGFHSHNNLGLAVANSLAAVEEGASYIDVTCRGLGAGAGNTQGEVFCAV
MERLGYETGVHCYELMDLAENVVEPIMLRPQVIRTDSLMLGYAGVYSSFLLHTRKAAEKY
GIAPRDILVELGKRRMVGGQEDMIVDVAYQLSQKK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggctaacagtaaaattaacatagtagataccaccctgcgggacggcagccatgcggtg
agccactcctttactgcggaacaggcggcagctgtggcagcggggctggataaggcgggg
attgagcttattgagataagccacggggacggcattgccggctcctccattaattacggc
ttttccaaggtttcggaactggatttgatagaagccgcaggaaaagtggtgaagaaagcc
aagctgggggtcctgctcctgccgggcataggaaccatcgaagacctgaaggaagcccgg
gagcggggggccaatgcggtccgggttgccacccatgtgactgaggcggatattgcggtc
cagcatatcgcctgggcaaagcaggcggggatgttcaccgtgggttttttgatgatgacc
cacatggcctctcctgagaccatcgttgaacaggcgaagatatttgtggacgccggggca
gattacatcaacctggcggattcttcgggctacatggtccccaaggatgtccgcgcccgg
ataggggcgcttaaagcggcgatcagtatccctgtgggcttccactcccacaacaacctg
ggcctagcggtagccaattccctggcggcggtggaagaaggggcctcgtacattgacgtt
acctgccggggcctgggcgctggcgccgggaatacccagggcgaggttttctgcgcggtg
atggaacggctgggctacgaaaccggggtacactgttacgagctcatggatctggcggag
aatgtggtggagcctataatgctgcggccccaggtgatacgcaccgattctctcatgttg
gggtacgctggggtttactccagcttcctcctccataccagaaaagctgcggaaaagtac
ggcatagccccccgggatatcctggtggagctggggaaacgccgcatggtgggcggccag
gaagacatgatcgtggatgtggcctatcagttgtcccagaaaaagtaa

DBGET integrated database retrieval system