KEGG   Treponema primitia: TREPR_1360
Entry
TREPR_1360        CDS       T01507                                 

Definition
(GenBank) D-ornithine aminomutase E component
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
tpi  Treponema primitia
Pathway
tpi00472  D-Arginine and D-ornithine metabolism
tpi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    TREPR_1360
Enzymes [BR:tpi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     TREPR_1360
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AEF84123
UniProt: F5YQT1
Position
2939782..2942001
AA seq 739 aa
MEKNTLKPNKKLDIENLLHDLDKYQPRRRGWTWRKSAPDLEMGPFKYRDASAPLTNGVSL
PSAKYFGAIDPQPLPVITTEIASGRFEDDIRRMRMAAWHGADHIMVIRTAGQSHIDGLME
GTPQGVGGVPITRKQVRAQRKALDLIEDEVGRPINYHSYVSGVAGPEVAVMFAEEGINGA
HQDPQYNVLYRNINMVRSFVDACESKKIMAWANMAQIDGAHNANATAREAWKVMPELIVQ
HAINSLFSAKVGIEKSNICLSTVPPTAPPAPCVFMDLPYAVALRDLCGEYRMRAQMNTKY
MEASARENTVTHVLNMLVSKLTSADIQSTITPDEGRNVPWHIYNIEACDTAKQTFMGLDG
LMDMVELKKDGPLTEKAREIKERACLFMEEILEAGGYFKAVEGGFFVDSGCYPERNGDAI
IRKADAGVGEGTIYERDEDYFAPVTAHYGYNNVAQYDPAAVSNPALLIGGCTFENPEKIV
YIDELDPTDNVSVRMAENAKYRNTNLLKPEMEWSADGVVMVNLFLPAERRVAEAAALEFA
AGMNLMDPEIINLEVLQEAEGVRIELKGKLPFDVDISKLHIPPVQEVLSREEIRADVATH
PLRVVCGTVGEDEHSVGMREIIDIKHGGIEGFGIEVHYLGTSVPVEKLVDAAIELNAEAL
LASTIISHDDIHYKSMKRIHELAVEKGIRDKIALIAGGTQVVPKLAVNAGMDAGFGRGCH
GIDVATFLIKHRREKRQKN
NT seq 2220 nt   +upstreamnt  +downstreamnt
atggagaaaaacactttaaaacctaacaaaaaactggacatagaaaacctgctccatgac
ctggacaaataccagcccaggcgcaggggctggacctggcggaaaagcgcgcctgacctt
gagatgggccccttcaaataccgggacgcctccgcccctttaacaaacggagtatccctg
ccctcagcaaaatacttcggcgctattgatccccagcccctgccggtgatcaccacggaa
attgcctcagggcgctttgaggatgatatacgcaggatgaggatggcggcctggcatgga
gcggaccacatcatggttatccgcaccgccgggcagtcccacattgacgggctcatggaa
ggcacaccccagggggtagggggggtgcccatcacccggaaacaggtccgggcccagaga
aaggccctggaccttattgaagatgaggtgggccggcccatcaattaccattcctacgtg
tccggtgttgcagggccggaagtggcagttatgttcgccgaagaagggatcaacggcgcc
caccaggacccccagtacaatgtgctatacagaaatattaacatggtccgatcctttgtg
gatgcctgcgaatcgaaaaagatcatggcctgggcgaacatggcccagatcgacggggcc
cacaacgccaacgctactgcccgggaagcctggaaggtgatgccggaactcattgtgcag
cacgccatcaacagccttttctccgcgaaggtgggtattgaaaaatccaatatctgccta
tccacggttccccctacagcgcccccggcgccctgtgtgttcatggacctgccctatgcg
gtggcacttcgggatctctgcggggaataccgcatgagggcccagatgaacactaaatat
atggaagcctccgcccgggagaacacggtgacccatgtgctgaacatgctggtctccaaa
ttgaccagcgcggatatacagtccaccatcacccccgacgagggccggaacgtaccctgg
cacatctacaacatcgaagcctgcgatacggcgaaacaaaccttcatgggcctggatggc
ctcatggacatggtggagctgaaaaaagacgggcccctgacagaaaaagcccgggagatc
aaagagcgggcctgcctctttatggaagaaattctggaagccgggggctacttcaaggcg
gtggaagggggattcttcgtggattcaggctgctaccccgaacggaacggggacgccatc
atccgcaaggccgacgccggggtcggagaagggaccatctacgaacgggacgaagactac
ttcgccccggtgaccgcccactacgggtacaataacgttgcccagtacgatcctgcagct
gttagtaatcctgcactccttatcggcggctgtacctttgagaacccggaaaagatcgtc
tatatcgacgaactggaccccacggacaacgttagtgtcaggatggcggaaaacgccaaa
taccggaataccaatctgctcaagccggaaatggaatggtccgccgacggcgttgtgatg
gtcaatttgttcctccccgcagaacggcgggtcgcagaagcggcggccctggaatttgcc
gccggaatgaacctcatggaccctgagataatcaacctggaggtcctgcaggaagcggag
ggggtccgcattgagctcaagggcaaactgccctttgatgttgatatcagcaagctccat
atccccccggtacaggaggtactgtccagagaggagatccgcgccgatgtggccactcat
cccctcagggtggtctgcggaaccgtgggggaggacgaacattccgtaggtatgcgggag
atcatcgacatcaagcacgggggcatcgaaggtttcggcatagaggtccactatctggga
acttcggtgcccgtagaaaaactggtggatgccgccattgagctgaatgcagaggcactg
ctggcttctaccatcatcagccacgatgatattcactacaagagcatgaagcgcatccac
gaactggcggtggaaaaggggatccgtgacaagatagccctgatagccgggggtacccag
gtggttcccaaactggcggtaaacgccggaatggacgccggtttcggcaggggctgtcac
ggcattgatgtggcaacttttctgatcaaacaccgccgtgaaaaacggcagaaaaactaa

DBGET integrated database retrieval system