KEGG   Treponema primitia: TREPR_1361
Entry
TREPR_1361        CDS       T01507                                 

Definition
(GenBank) D-ornithine aminomutase S component
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
tpi  Treponema primitia
Pathway
tpi00472  D-Arginine and D-ornithine metabolism
tpi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    TREPR_1361
Enzymes [BR:tpi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     TREPR_1361
SSDB
Motif
Pfam: OAM_alpha Rubella_Capsid
Other DBs
NCBI-ProteinID: AEF85919
UniProt: F5YQT0
Position
2939413..2939769
AA seq 118 aa
MKRQDDFTERRKHLATLNDEELYRHFWELTAKVVDPLLELGKKNTSPSIERSVLLRMGFS
SPDTKAIVEGCIDQELLGKGAGHVVYRLSKLKNISINEAGAMLAAGQGWNDAVALFKA
NT seq 357 nt   +upstreamnt  +downstreamnt
atgaaacgacaggatgatttcactgaaaggcgaaagcacttagccactcttaatgatgaa
gaactgtaccggcatttctgggaactgactgccaaagtggtggacccccttctggaattg
ggtaaaaaaaatacctccccttctatagaacgatcagtattactgcgcatgggattttca
tccccagacactaaggctatcgtggaggggtgcatagaccaggagcttttggggaaaggg
gccggccatgtagtctataggctttccaaattaaaaaatatttccataaatgaagccggc
gctatgctggctgcggggcagggctggaatgatgctgttgccctgtttaaggcataa

DBGET integrated database retrieval system