KEGG   Treponema primitia: TREPR_2242Help
Entry
TREPR_2242        CDS       T01507                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
tpi  Treponema primitia
Pathway
tpi00471  D-Glutamine and D-glutamate metabolism
tpi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    TREPR_2242 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tpi01011]
    TREPR_2242 (murI)
Enzymes [BR:tpi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     TREPR_2242 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:tpi01011]
 Precursor biosynthesis
  Racemase
   TREPR_2242 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AEF84925
UniProt: F5YIG1
Position
complement(1996132..1997025)
Genome map
AA seq 297 aa AA seqDB search
MDNRPILFLDSGIGGLPYCQHFHHHNPHEALVYCADREHFPYGRREREELIALLSSLVAR
LRGQFNPKLGVIACNTATVSALASLRETFPDLPLVGTVPAVKPAVLASKRRHIGVLGTDR
TIRDPYIAELAARFGPDCAVTALAAPDLVDFVEHRYALAGEEERRSIASPYIEEFRRAGA
DAIVLGCTHFLFLLDDFKALAKGELSIHDSIAGVSRRAEALLDQGGLRAGVTAETSAAEG
PAALLLVTGLEPLEPVWEERAQAFGLTLCAGNFVAKCAGNLPTKVGIASGPDQGGRP
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggataatagacctatactttttttggactccggtatcgggggccttccctactgccaa
cattttcaccaccacaatcctcatgaagctctggtctactgtgcggaccgggaacatttt
ccctacgggcgccgggaacgggaagagttgatcgccctgttaagcagccttgtggcacgg
cttcgggggcagtttaaccccaagctgggagtgattgcctgcaataccgccacggtgtca
gccctggcttcacttcgggaaacctttcccgatctgcccctggtgggtaccgtgccggcg
gtgaaacctgcggtccttgccagcaagcgccggcatatcggggtgctggggactgacagg
accatcagggatccctatatcgcggaactggcagcccggttcgggccggactgcgcggtc
actgcccttgccgctccggacctggtagactttgtggaacaccggtatgcccttgccggg
gaagaggagcgccggagtatagcctctccttacatcgaagaattccgccgggcaggggct
gacgctatagtcctgggctgtacccacttcctttttcttttggatgattttaaggccctg
gccaaaggggagctttccatccacgattccattgcaggggtttcccgccgggcagaggcc
ctgttggatcaggggggattgcgagctggtgtgacagcggaaacttcggcagccgaaggc
ccggcagctttactgctggttaccggccttgagccgcttgagccggtctgggaagaacgg
gcgcaagccttcggcctgaccctttgcgcggggaacttcgttgcaaaatgcgcggggaac
ttgccgactaaagtcggtattgcaagtggtcccgatcagggggggcgtccatga

DBGET integrated database retrieval system