KEGG   Treponema primitia: TREPR_3602Help
Entry
TREPR_3602        CDS       T01507                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
tpi  Treponema primitia
Pathway
tpi00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:tpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    TREPR_3602
Enzymes [BR:tpi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     TREPR_3602
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     TREPR_3602
    1.1.1.-  
     TREPR_3602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C I-EGF_1
Motif
Other DBs
NCBI-ProteinID: AEF86816
UniProt: F5YR19
Position
complement(562351..563400)
Genome map
AA seq 349 aa AA seqDB search
MKAAVWYGYKDIRICDRPLPGTLPGHVTVKVAWAGICGTDRHEYLGPNFIPVKKPHRLTG
VTAPLILGHEFTGTISEIGEGVTGWEIGDRVTANGTLSCGTCEACRSGRYNICEKLGFVG
VSRDGAFAEYVSVEAARLFKIPDTLTLRRAVLAEPLACGIHSTRLLGDIRGKNAVIVGPG
IIGLSCFFAAKFAGAGKLIVAGMGELRKELVEQNGGIYVDVEKQNLKEVAAQSFGGLADI
CYECVGAQSSLDSSLDILKSGGALMVMGVYEKPPVFRMNDFQEGERRLFTSQAHVDEIAS
ALDNLDRGLVDADTLVTRELTLDTLVDQGFEELAANNAKHIKMLIRIGG
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcggtttggtatggttataaggatatacgcatctgtgatcgtcccctgccc
ggaacgcttccggggcatgtaacggtcaaagtcgcttgggcgggaatctgcggcaccgat
cgccacgaatacttagggcccaattttatccccgtgaaaaagccccaccgcctcaccggg
gtcaccgcccccctgatcctgggccacgaattcaccgggaccatcagcgaaatcggcgaa
ggcgttacgggctgggaaatcggtgaccgggttaccgccaacggcaccctgagctgcggc
acctgcgaagcctgccggtccgggcgctacaatatctgcgaaaagctgggctttgtgggg
gtcagccgggacggcgcctttgccgaatatgtgagcgtggaagcggcccggctctttaag
atacccgacaccctcaccctgcggcgggcggttctggcggaacccctggcctgcggcatc
cactccacccggctcctgggagacatccggggcaaaaacgccgtcatcgtcgggccgggg
atcatcggcctgtcctgcttctttgctgcaaaattcgccggcgcgggaaagcttattgtg
gcaggcatgggggagctgcggaaggaactggtggaacaaaacggcggcatctatgttgat
gtggaaaaacaaaatttgaaggaagtggcggcccaaagtttcggcggcctggcggacatc
tgctatgagtgtgtgggcgcccagtcttccctggactcaagcctggacatactgaaaagc
ggcggcgccctcatggtcatgggggtctacgaaaagcccccggtctttcgcatgaacgac
ttccaggaaggggaacggcggctcttcacttcccaggcccatgtggacgaaattgcaagc
gccctggacaacctggaccgggggctggtcgacgccgacaccctggttacccgagagctg
accctggataccctggtggatcagggctttgaggagctggcggcgaataacgcgaagcat
attaagatgctgatacggatcggcgggtaa

DBGET integrated database retrieval system