KEGG   Treponema putidum: JO40_03870Help
Entry
JO40_03870        CDS       T03278                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
tpk  Treponema putidum
Pathway
tpk00260  Glycine, serine and threonine metabolism
tpk01100  Metabolic pathways
tpk01110  Biosynthesis of secondary metabolites
tpk01120  Microbial metabolism in diverse environments
tpk01130  Biosynthesis of antibiotics
tpk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JO40_03870
Enzymes [BR:tpk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     JO40_03870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIN93358
UniProt: A0A088RCE5
Position
complement(805707..806756)
Genome map
AA seq 349 aa AA seqDB search
MYFFINDYSEGCHPKILQKLMETNEEQTAGYGCDKYCEEAAGLILKELDAPQSKVYFFSG
GTQTNLTLIASTLRPHQGVIAADTGHINVHESGAIEACGHKVLTIETLNGKITAGQAEAL
IRAHYDDPTAEHMVQPGMIYISNPTELGTIYSKKELQDLKLTAQKYSVPLYVDGARLGTA
LTADNNDLSLADMARYTDAFYIGGTKMGALFGEALIINNPEMQKDFRYIQKQKGGLFAKG
RLLGLQFKTLFTDNLYFEIGKMMNKTAKMIRKGFSDRGFSFLIESETNQSFPIIENSLLA
KIEKKFKCEFWTKVSENQTAVRFCTSWATKEEAVKKLFEFLDEISSQTN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtatttttttataaatgattatagcgagggttgtcatccgaaaattcttcaaaaacta
atggaaacaaatgaagagcaaactgccggttacggctgcgacaaatattgtgaagaagcg
gcaggcctcattttaaaagaattggatgcacctcagagtaaggtttattttttttcaggc
ggaacacagaccaacttaactttgatagcttctacactaaggcctcatcaaggagtaata
gccgcagatacggggcatataaacgtacacgaatcgggtgcaatagaggcttgcggacac
aaggttcttaccattgaaacgctaaatggaaaaataacggcagggcaagctgaggctctt
ataagggctcattatgatgatcccacggccgaacacatggttcagcccggaatgatttat
atttccaatcctaccgagctcggcaccatttattcaaaaaaagaattacaggatttaaag
ctgaccgctcaaaaatattccgtacctctctatgttgacggtgcccgcctgggaacagcc
ctcaccgccgacaataacgatttaagccttgcagacatggcaaggtacacggatgccttt
tatataggcggaacaaaaatgggggctcttttcggagaggctcttatcatcaacaatcct
gaaatgcaaaaagactttagatacatccaaaagcaaaagggagggctctttgcgaagggc
agactcttaggccttcagtttaaaacgctttttacggataacctttattttgaaatagga
aaaatgatgaacaaaacggctaagatgatccgtaaaggtttttccgatagaggtttttct
tttttgatagaaagtgaaacaaatcaaagttttcccataatcgaaaacagccttttagct
aaaatagaaaaaaaatttaaatgcgaattttggacaaaggtttcggaaaaccaaacggca
gtgcgcttttgtacctcgtgggcgacaaaagaggaagccgtaaaaaaactgtttgaattc
ttggacgaaatatcttcacaaactaattaa

DBGET integrated database retrieval system