KEGG   Treponema paraluiscuniculi: TPCCA_0476Help
Entry
TPCCA_0476        CDS       T01555                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
tpl  Treponema paraluiscuniculi
Pathway
tpl00430  Taurine and hypotaurine metabolism
tpl00620  Pyruvate metabolism
tpl00640  Propanoate metabolism
tpl00680  Methane metabolism
tpl01100  Metabolic pathways
tpl01120  Microbial metabolism in diverse environments
tpl01200  Carbon metabolism
Module
tpl_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:tpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TPCCA_0476 (ackA)
   00640 Propanoate metabolism
    TPCCA_0476 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    TPCCA_0476 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    TPCCA_0476 (ackA)
Enzymes [BR:tpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     TPCCA_0476 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AEH40415
UniProt: F7XST2
Position
complement(502540..503886)
Genome map
AA seq 448 aa AA seqDB search
MIILTLNCGSSSVKYQVYNWTERAVIAVGVVERVTQAGSVITHEVHGRENHVRESPCPTH
TEAVQLIISTLTDAHVGVISDMSLIKAVGHRVLHAADRFVKSVVVTPDVLETFRSVQDLG
PLHNPANIRGIEAAQAVIPSVPHCAIMDTAWHQTMPEASFMYAVPRQWYEEYAVRRYGFH
GTSFLYTAKRASVILKKRAEDTNIIIAHIGNGASMCCVKNGVSFDTSMGITPLEGLIMGT
RCGDCDPALAFYIMRKTGMSVSDIDTTLNKQSGLLGITGKYVDRRDVCAAMKNGDALARL
AFDMEVHRIRKYFGAYVAALGKQPDALVFTAGVGEMCCDVRAAACAGLEHLGIRLDARKN
ELARTRNAETEISTDDSPVRILVIPTDEELVMTEDTYALMQGTYDVHTRFTYSFQDPTYV
NKARAAGLKRDLEKNPALATIVVPRLDT
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgattatcctcacgctaaactgcggcagttcatctgtaaaataccaggtgtataactgg
acagagcgtgcggtgattgccgtcggcgtggtagagcgtgttactcaggcaggatctgtt
atcacgcatgaggtgcacggccgagagaaccacgttcgggaaagtccctgccctacccat
accgaagcggtgcagcttatcatcagcaccctcaccgatgcgcacgtcggtgttatcagc
gacatgagtcttatcaaggcagttggacaccgcgtcctacacgcagcagatcgctttgta
aagtctgtcgttgtgactcctgacgtgctagaaacgtttcgctctgttcaagaccttggc
cctctccacaaccccgcaaacatccgtggtattgaggctgcccaggcggtcatcccctca
gttcctcactgtgccattatggatactgcgtggcatcaaaccatgccagaagctagcttc
atgtacgcagtgccccggcagtggtacgaagaatatgcggtacgtcgctacggctttcac
ggcacgagttttctttatactgcaaagcgcgcctctgtcattctcaaaaaaagggctgag
gacacaaacataatcattgcgcatattggaaacggcgcttccatgtgttgtgtcaaaaat
ggtgtcagctttgacacttccatgggcatcaccccgctagaaggcctgattatgggaaca
cgctgcggggactgcgaccctgcgcttgccttttacattatgagaaaaacaggcatgtct
gtctcagacatcgacaccactctcaataaacagtccggtttgctaggtatcaccggaaaa
tacgtggatcgacgcgatgtgtgtgctgccatgaaaaatggagacgcgcttgcacgcctt
gcctttgacatggaggtacaccgcatccggaaatacttcggcgcatacgttgcagctttg
ggtaaacagccggacgcgcttgtctttaccgcaggcgttggagagatgtgctgcgacgta
cgcgcagcagcgtgcgcaggactcgaacacctaggcatccgacttgatgcgcgaaaaaat
gaactcgcccgcacgcgcaatgcagaaactgaaattagtacagacgattcacccgtccgc
attctggtaatcccaacagatgaagaattggtcatgaccgaggacacgtatgcactcatg
cagggaacatacgacgtgcacacgcgttttacctactcgttccaggatccaacctatgtc
aataaggcgcgggcagcaggattaaaaagagatttagaaaagaacccggcactcgcgacg
attgtcgtgccgcgtcttgatacatag

DBGET integrated database retrieval system