KEGG   Treponema pallidum subsp. pertenue SamoaD: TPESAMD_0056Help
Entry
TPESAMD_0056      CDS       T01751                                 

Gene name
oadA
Definition
(GenBank) oxaloacetate decarboxylase subunit alpha
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
tpm  Treponema pallidum subsp. pertenue SamoaD
Pathway
tpm00620  Pyruvate metabolism
tpm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TPESAMD_0056 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tpm02000]
    TPESAMD_0056 (oadA)
Enzymes [BR:tpm01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     TPESAMD_0056 (oadA)
Transporters [BR:tpm02000]
 Other transporters
  Primary active transporters [TC:3]
   TPESAMD_0056 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 ADH_zinc_N His_biosynth HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: AEZ57171
Position
64369..66150
Genome map
AA seq 593 aa AA seqDB search
MSTPVRISEMVLRDAHQSLHATRMTTEDMLPICDKLDRVGYWSLEAWGGATYDACIRFLN
EDPWERLRALKARLPKTPIMMLLRGQNLLGYRHYADDVVDAFVEAAARNGVDVFRIFDAL
NDPRNLSQAARAAKKTGKHVQMAISYATTPYHTAEKYVELAKEYARFGADSICIKDMSGL
LTPYGAYDLVSAIKKSVDLPVELHTHATTGMSVATLVKAAEAGVDVIDTAIASMSMGTSH
SPTETLVEILRHTGRDSGLDINLLLEIAAYFRQVRKCYAQFESSFLGADTRILVSQVPGG
MLSNLENQLREQGALDKMDQVLKEIPLVQKDCGYIPLVTPTSQIVGTQSVLNVLFGRYHR
LTAETRRLLTGQYGRTPASCDAGLVERALKEEKLSQSLVCRPADALPHELDRMRSEARAA
GAQDTIEDVLTYAMFPKIAPTFFASRAQGPISFRGKGQGQKQKGESAGSVASYVATVNGT
AYTVVQEGAVLRVNGTPYTVRVEAGPSVASGTSQGTVTTAKVGACTTLPAPVAGSVVKHT
VQDGATVNSGETVLMVESMKMELEVKATAAGTIHFLIAPGAHVSAGQVLAEIR
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccccggttcgcattagcgaaatggtcctacgtgatgcgcatcagtctttgcac
gctacgcgcatgactaccgaagacatgctccctatttgtgacaagctagatcgcgttggg
tattggagtttggaggcgtggggaggcgccacgtacgacgcctgcattcgctttctaaat
gaggatccctgggagcgtttgcgtgctctcaaagctcggttacctaagacccctattatg
atgcttttgcgtgggcaaaacttgctaggctaccggcattacgcggatgacgttgtagat
gcgttcgtagaggccgctgcgcgcaacggcgttgatgtgttccgcatcttcgatgcactt
aatgacccacgtaacctcagtcaggctgcgcgtgctgcaaagaaaacaggcaagcatgtg
cagatggctatctcttacgctaccacaccctatcataccgcagagaagtacgtagagtta
gcaaaggagtatgcgcgcttcggtgcggattctatttgcattaaggatatgtcggggttg
ctgaccccgtacggggcgtacgatctggtttctgccattaaaaagagtgtcgatttgccc
gttgagttgcacacccacgccactactggtatgtctgttgcaaccctggtgaaggcggca
gaagcaggtgttgatgtaattgacactgccattgcttctatgtccatgggtacttcccac
agccctacagagactttagtggaaatcctacggcacacgggccgtgactcagggctcgac
ataaatctcctgctagaaatagcagcctacttccgtcaggtacggaagtgctatgcccag
tttgagtctagttttctgggtgcagacacgcgtatcctcgtgtcccaggtgcctgggggt
atgctttccaatttagaaaaccagttgcgtgagcagggagccctggataagatggaccag
gttcttaaggaaattcccctggtacagaaggactgcggttatatcccgcttgtgactcct
acgagtcagattgtaggtacgcagtcagtattgaacgtgctgtttggccggtaccaccgg
cttactgctgagacaaggcgtctgctcacgggtcagtatggccggactcccgcctcctgt
gatgcaggtttggtggagcgggccttgaaggaagaaaagttatcgcagtcgcttgtctgc
cgcccagcggatgccttgcctcatgagcttgatcgcatgaggtctgaggcgcgcgccgca
ggcgcacaggataccattgaggatgtgctcacgtatgctatgtttcccaagatcgctccc
acattctttgcttcccgtgcgcaagggcctatttcgttcagaggaaaggggcaggggcaa
aaacagaagggtgagagtgcagggtcggtagcttcttatgtggctaccgtaaatggtact
gcgtacacagttgtgcaggaaggcgctgttctccgggtaaatggtactccctacaccgtt
agggttgaggcaggcccgtccgttgcttcgggtacgtcgcagggtaccgtgactacggca
aaggttggggcgtgtactacgctacccgcgccggtcgcaggtagcgtagttaaacacacc
gtgcaagatggagctacggtaaattcgggggagacggtgctcatggtggagtccatgaag
atggaacttgaagtgaaggccaccgctgctggtactatccatttcctaatagcgcctggc
gcgcatgtcagtgcggggcaagtcttagcagagattcgctag

DBGET integrated database retrieval system