KEGG   Treponema pallidum subsp. pallidum Mexico A: TPAMA_0351Help
Entry
TPAMA_0351        CDS       T02273                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
tpo  Treponema pallidum subsp. pallidum Mexico A
Pathway
tpo00330  Arginine and proline metabolism
tpo00332  Carbapenem biosynthesis
tpo01100  Metabolic pathways
tpo01130  Biosynthesis of antibiotics
tpo01230  Biosynthesis of amino acids
Module
tpo_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tpo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TPAMA_0351 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    TPAMA_0351 (proB)
Enzymes [BR:tpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     TPAMA_0351 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: AFU66359
Position
377104..377994
Genome map
AA seq 296 aa AA seqDB search
MIRALFAAAKKIVIKIGSNTLAQADGTPDEEFLAECARACAALMRDGKQIVVVSSGAQVA
GISALHCLSSPPQGAGLERHESRGVIPGDGASCKQALCAVGQAELISRWRSAFAAHQQCV
GQFLCTKEDFTDSDRAAQVRYTLSFLLERRVVPILNENDALCCSDVPSVPADRRVSLSPQ
KRIGDNDSLSAFVALLWQADLLLLLSDIDGVYDKDPKAHTDAQHVPLVTDVSALVGKTSM
GSSNVFGTGGIATKLDAARLVTRAGIPLVLANGRHLDPILSLMRGDARGTLFVPVS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgatccgtgcgctttttgctgcggcaaaaaaaattgtgataaagattgggtcaaatacg
cttgcgcaggcagatggtactcctgatgaggagtttttggcggagtgtgctcgcgcctgt
gcggcgctgatgcgtgacggcaagcagatagttgtggtgtcgtctggcgctcaggttgca
gggatttctgcgctccattgcctttcatctcctcctcagggggcgggtttagagcgtcac
gaatcgcgcggcgttattccgggtgatggtgcgtcctgcaaacaggcgttgtgtgcggtg
ggtcaggcggagttgataagtcgttggcgttctgcgtttgcagcgcaccagcagtgcgtg
ggccagtttctgtgtacgaaggaggattttactgactcggaccgcgcggcgcaggtacgc
tacacgttgtcctttttgctcgagcgcagggtagtacctatccttaatgaaaatgacgcg
ctctgttgcagcgacgtcccctctgtacccgccgaccggcgggtgtccctatcacctcaa
aaaaggattggagataatgacagtctgtccgcgtttgtagcgctgttgtggcaggcagat
cttttgcttttgttgagtgacattgacggcgtgtatgacaaagacccaaaggcacacaca
gatgcgcagcacgttcctctggtgacggacgtgtcagcgcttgtgggtaaaacgagcatg
ggttcttccaatgtctttggtacgggtgggattgctacaaagctggatgctgcgcgtctt
gtcacgagggcgggaattcctctggtgctggcaaacgggcgccatctggatccgatcctg
agccttatgcgcggggatgcgcgggggacacttttcgtgcctgtttcttag

DBGET integrated database retrieval system