KEGG   Treponema pallidum subsp. pallidum SS14: TPASS_0351Help
Entry
TPASS_0351        CDS       T00716                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
tpp  Treponema pallidum subsp. pallidum SS14
Pathway
tpp00330  Arginine and proline metabolism
tpp00332  Carbapenem biosynthesis
tpp01100  Metabolic pathways
tpp01130  Biosynthesis of antibiotics
tpp01230  Biosynthesis of amino acids
Module
tpp_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tpp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TPASS_0351 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    TPASS_0351 (proB)
Enzymes [BR:tpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     TPASS_0351 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: ACD70777
UniProt: B2S2U8
Position
377102..377992
Genome map
AA seq 296 aa AA seqDB search
MIRALFAAAKKIVIKIGSNTLAQADGTPDEEFLAECARACAALMRDGKQIVVVSSGAQVA
GISALHCLSSPPQGAGLERHESRGVIPGDGASCKQALCAVGQAELISRWRSAFAAHQQCV
GQFLCTKEDFTDSDRAAQVRYTLSFLLERRVVPILNENDALCCSDVPSVPADRRVSLSPQ
KRIGDNDSLSAFVALLWQADLLLLLSDIDGVYDKDPKAHTDAQHVPLVTDVSALVGKTSM
GSSNVFGTGGIATKLDAARLVTRAGIPLVLANGRHLDPILSLMRGDARGTLFVPVS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgatccgtgcgctttttgctgcggcaaaaaaaattgtgataaagattgggtcaaatacg
cttgcgcaggcagatggtactcctgatgaggagtttttggcggagtgtgctcgcgcctgt
gcggcgctgatgcgtgacggcaagcagatagttgtggtgtcgtctggcgctcaggttgca
gggatttctgcgctccattgcctttcatctcctcctcagggggcgggtttagagcgtcac
gaatcgcgcggcgttattccgggtgatggtgcgtcctgcaaacaggcgttgtgtgcggtg
ggtcaggcggagttgataagtcgttggcgttctgcgtttgcagcgcaccagcagtgcgtg
ggccagtttctgtgtacgaaggaggattttactgactcggaccgcgcggcgcaggtacgc
tacacgttgtcctttttgctcgagcgcagggtagtacctatccttaatgaaaatgacgcg
ctctgttgcagcgacgtcccctctgtacccgccgaccggcgggtgtccctatcacctcaa
aaaaggattggagataatgacagtctgtccgcgtttgtagcgctgttgtggcaggcagat
cttttgcttttgttgagtgacattgacggcgtgtatgacaaagacccaaaggcacacaca
gatgcgcagcacgttcctctggtgacggacgtgtcagcgcttgtgggtaaaacgagcatg
ggttcttccaatgtctttggtacgggtgggattgctacaaagctggatgctgcgcgtctt
gtcacgagggcgggaattcctctggtgctggcaaacgggcgccatctggatccgatcctg
agccttatgcgcggggatgcgcgggggacacttttcgtgcctgtttcttag

DBGET integrated database retrieval system