KEGG   Treponema pallidum subsp. pallidum SS14: TPASS_0406Help
Entry
TPASS_0406        CDS       T00716                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
tpp  Treponema pallidum subsp. pallidum SS14
Pathway
tpp00471  D-Glutamine and D-glutamate metabolism
tpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    TPASS_0406 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tpp01011]
    TPASS_0406 (murI)
Enzymes [BR:tpp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     TPASS_0406 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:tpp01011]
 Precursor biosynthesis
  Racemase
   TPASS_0406 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race DUF3565
Motif
Other DBs
NCBI-ProteinID: ACD70832
UniProt: B2S303
Position
431206..432012
Genome map
AA seq 268 aa AA seqDB search
MSDRREQFQYAFLDSGIGGLPYAHALRVRVPEASLVYVADRVYFPYGNKSSAQIIARASA
VLQKVQTNFSPHIVVLACNSMSVNALEFLRAQVSVPVVGVVPAIKQAVACSHKKHIGVLA
TQCTITHPYTACLRAQFGAGCVFQMRADARLIECLERGLIFEVEDMQREAVARSVMPFQE
AGVDVLVLACTHFVHVRHLFQDCVGTSCTVVDSLEGVVRRTLRLCPPQSQLRGNAACYVT
GARDAVCAARYARYAQHFGLRWAGFLDV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaccgacgtgagcaatttcaatacgcatttttggattcaggtataggaggattg
ccctacgcacacgccttacgcgtgcgtgtgcctgaggcctcactggtgtacgtggcggac
cgtgtatactttccttatgggaataaaagttctgcacagattattgcgcgtgcgtctgca
gttttgcagaaagtgcagacgaatttttcaccacacatagtggtactcgcgtgtaacagc
atgtctgtcaatgcacttgagtttttgcgtgcgcaggtttcggttccagtggtgggggtg
gtgcctgcaattaagcaggcggtggcgtgcagtcataaaaagcacattggtgtcttagct
acacaatgcacgattacgcatccgtacacagcgtgtttgagagcacagtttggtgcaggg
tgtgtgtttcagatgcgtgcggatgcacgccttattgagtgtcttgagcgcgggttaatt
tttgaagtcgaagacatgcagcgggaggcagtggcgcgctcagttatgcccttccaggaa
gcgggggtggatgtgctcgtgctcgcgtgcacccattttgtgcacgtgcgtcatcttttt
caggactgtgttggtacctcgtgtacggtggtagattcgctagaaggtgtggtacgcagg
acgttacgtctgtgtccaccgcaatctcaattgcgtgggaacgccgcctgttacgtaact
ggtgcgcgcgatgcagtgtgcgcggcacgatacgcacggtatgcgcagcactttggattg
cgctgggcgggttttttggacgtatga

DBGET integrated database retrieval system