KEGG   Treponema pallidum subsp. pallidum SS14: TPASS_0903Help
Entry
TPASS_0903        CDS       T00716                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
tpp  Treponema pallidum subsp. pallidum SS14
Pathway
tpp00471  D-Glutamine and D-glutamate metabolism
tpp00550  Peptidoglycan biosynthesis
tpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    TPASS_0903 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TPASS_0903 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tpp01011]
    TPASS_0903 (murD)
Enzymes [BR:tpp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     TPASS_0903 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:tpp01011]
 Precursor biosynthesis
  Amino acid ligase
   TPASS_0903 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: ACD71319
UniProt: A0A0H3BKA3
Position
986325..987923
Genome map
AA seq 532 aa AA seqDB search
MEQARALLQGKTVTIMGLGVHGGGCAAACFCAEAGARLTVTDLRNADALTPSLKRLRAYP
SIRFTLGEHRLEDFENAHVVIKNPIVKGAHNIYLSAAQRAGARIETDISLFLRLSPAPLL
AVSGSKGKSSTASALCYSLRALGFPAFLGGNSTVSPLEFVRHTTPATPVVLELSSWQLAD
LRAVDAQDHTVHHAGLLRPEIAIMTPIMADHQNWYADMESYVADKQVLYAHQGTHDTLLC
NADDGWGPRFACEAQKNGVRVFWYTAQSPETACRACTPRLMERALWRATDGTYWARFAEG
DRACMLIPPQLHVPGRVLQTQVASAALAALLFAQRHSLPPSSCPPCFCAHSHSPAYANHA
SPPDYACPSAHSPFQEHTRRLAQALESYTGIEHRLEFFYEKGGLRFYNDSASTVPEATIA
ALEAFDESVVLIVGGTDKNADYQPLAQAAAKAHALYLLAGSATARLQPLLHAAQVPFYGP
FTSLEVLLQDLRARQKSPGVIVFSPGAASFELFAHEFERGTTFKSQVRIIFE
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
gtggagcaggcgcgcgcacttcttcaaggcaaaacggtaaccatcatgggcctcggcgtg
cacggcgggggctgcgcggcagcctgcttttgtgcagaagcgggagcgcgccttacggtt
accgacctgcgaaatgctgatgcgcttaccccttccctgaaaagacttcgtgcgtacccg
tccatccgctttacgctcggtgaacaccggctggaagattttgaaaacgcgcatgttgtc
atcaaaaatcccatcgtgaagggtgcacacaacatctacctttccgctgctcaacgcgcc
ggcgcgcgcatcgaaacggatatctcccttttcctacgcctttctcccgccccgctgcta
gcagtaagcggcagcaagggaaaatcctccactgccagcgccctgtgctacagcttgcgt
gcgctgggtttccccgcctttctaggggggaatagcacagtcagcccgctggaatttgtg
cgtcacacaacgcctgcaacaccagtggttctggaactgtcgagctggcagcttgcagac
ctacgcgcagtcgatgcacaggaccacactgtacaccacgccggtctgctgcgcccggag
attgccatcatgactcccattatggctgaccatcaaaactggtatgcggatatggaaagc
tacgtggcagacaaacaggtgctatacgcacaccagggaacgcacgatacactgctgtgt
aacgcagatgacgggtggggaccccgctttgcctgcgaagcgcagaaaaacggagtgcgc
gtcttttggtatacggcccagtcgcctgagaccgcttgccgcgcgtgcaccccgcgcctc
atggagagagctctatggagagcgacggacggaacctactgggcacgttttgcagaaggt
gaccgcgcctgcatgctcatcccaccgcagctgcacgtaccgggccgtgtcctccaaacg
caagtggcgagtgcagcgcttgcagcgctcctgttcgcgcagcggcattctctacctcct
tcctcctgccccccgtgtttttgcgcacactcccattcccccgcgtacgcgaatcacgcg
tcccccccagactacgcttgtccgtccgctcacagtcccttccaagagcacacccggcgt
cttgcacaagcgctggagtcctacacgggcatcgaacaccgactagagtttttttacgaa
aaggggggactgcgtttttataacgattctgcatccactgtacctgaggcaacaattgca
gcgctggaagcctttgatgaaagcgtggttcttatcgttggcggcactgataagaatgca
gactaccaacccttggcacaggcagcagccaaggcgcacgcattgtacttgcttgcagga
agtgctacggcacggttgcaaccacttcttcatgcagcacaggtacctttttacggaccg
tttacttcccttgaggtactcctgcaggatctccgggcgcggcagaaaagcccaggcgtg
atcgtgttctctcctggggcagcgagttttgaacttttcgcccacgagtttgagcgaggt
actacctttaaatcccaggtgcgtatcatttttgaataa

DBGET integrated database retrieval system