KEGG   Tsukamurella paurometabola: Tpau_0966Help
Entry
Tpau_0966         CDS       T01228                                 

Definition
(GenBank) succinate dehydrogenase cytochrome b subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00020  Citrate cycle (TCA cycle)
tpr00190  Oxidative phosphorylation
tpr00650  Butanoate metabolism
tpr01100  Metabolic pathways
tpr01110  Biosynthesis of secondary metabolites
tpr01120  Microbial metabolism in diverse environments
tpr01130  Biosynthesis of antibiotics
tpr01200  Carbon metabolism
Module
tpr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tpau_0966
   00650 Butanoate metabolism
    Tpau_0966
  Energy metabolism
   00190 Oxidative phosphorylation
    Tpau_0966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS SdpI DUF5345
Motif
Other DBs
NCBI-ProteinID: ADG77599
UniProt: D5UUM8
Position
complement(990243..990710)
Genome map
AA seq 155 aa AA seqDB search
MTTANEPKLAKTLLKQYDRPASLDNPRSPHRPTGGNFEKYAWLFMRFSGIALLVLVFGHV
FIMLALDSDGVHRINAAFVAQRWASPFWQIWDITMLWLAQLHGGNGLRVIIDDYAKKDRT
RFWLKALLVLSMILVVGLGSYALLTFEPASVPTAQ
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgcgaacgagcccaagctcgccaagacgctgctcaagcagtacgaccgcccc
gcctcgctcgacaacccccgctccccgcaccgtcccaccggcggcaacttcgagaagtac
gcatggctgttcatgcgcttctcgggcatcgccctgctggtgctggtcttcggccacgtt
ttcatcatgctggcgctcgacagcgacggcgtgcaccggatcaacgccgcgttcgtcgcg
cagcgctgggccagcccgttctggcagatctgggacatcaccatgctgtggctcgcccag
ttgcacggcggcaacggcctgcgcgtgatcatcgatgactacgccaagaaggaccgcacc
cgcttctggctcaaggcactgctcgtcctgtcgatgatcctcgtggtcggcctcggctcg
tacgcgctgctcacgttcgaaccggcctccgtgcccaccgcgcagtag

DBGET integrated database retrieval system