KEGG   Tsukamurella paurometabola: Tpau_3268Help
Entry
Tpau_3268         CDS       T01228                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00040  Pentose and glucuronate interconversions
tpr00052  Galactose metabolism
tpr00500  Starch and sucrose metabolism
tpr00520  Amino sugar and nucleotide sugar metabolism
tpr01100  Metabolic pathways
tpr01130  Biosynthesis of antibiotics
Module
tpr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tpau_3268
   00052 Galactose metabolism
    Tpau_3268
   00500 Starch and sucrose metabolism
    Tpau_3268
   00520 Amino sugar and nucleotide sugar metabolism
    Tpau_3268
Enzymes [BR:tpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tpau_3268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Imm75
Motif
Other DBs
NCBI-ProteinID: ADG79853
UniProt: D5UVS1
Position
complement(3368388..3369284)
Genome map
AA seq 298 aa AA seqDB search
MNSPSLPKTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAEEAAAAGAERLCIVT
SPGKDGVVAHFVEDLVLEGTLEKRGKKAMLDKVRRAPNLIHAEAVVQDKPLGLGHAVSCV
EPVLDPDEDAISVLLPDDLVLPIGVLTTMAKVREKRGGSVLCAIEVSPEQISSYGAFDVE
IVPDAANPDVLKVNGMVEKPKAEDAPSNYAAAGRYLLDRAIFDALRRIEPGAGGELQLTD
AIALLISEGHPVHVVVHRGTRHDLGNPGGYLKAAVDLALDRDDYGPDLRGWLQDRLNR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgccgtcactcccgaagaccgcggtcgtccccgccgccggcctcggcacccgc
ttcctccccgcgaccaagacggtccccaaggaactcctcccggtggtcgacaccccgggc
atcgaactcgtcgccgaagaagccgctgccgcgggtgccgagcggctctgcatcgtcacc
agtcccggtaaggacggcgtcgtcgcccacttcgtcgaggacctcgtcctcgagggcacg
ctcgagaagcgcggcaagaaggcgatgctcgacaaggtccgccgcgcccccaacttgatc
cacgccgaagccgtggtccaggacaagccgctcggcctcggacacgccgtctcctgcgtc
gagcccgtgctcgaccccgacgaggacgcgatctcggtgctcctgcccgacgatctggtg
ctgccgatcggcgtgctcaccaccatggccaaggtgcgcgagaagcgcggcggctcggtc
ctgtgcgcgatcgaggtctcgccggagcagatcagcagctacggcgccttcgatgtcgag
atcgttcccgacgccgcgaacccggatgtgctcaaggtcaacggcatggtcgaaaagccg
aaggccgaggacgcaccgtcgaactacgcggcggccggccgctacctgctggaccgcgcc
atcttcgatgcgctgcgccggatcgagcccggcgccggcggcgaactccagctcaccgat
gccatcgctctgctcatcagcgaggggcatccggtgcacgtggtggtgcaccgcggtacc
cgacacgatctcggaaatcccggtggctacctcaaggctgcggttgacttggccctggac
cgtgacgactacggacccgacctgcgaggctggctgcaggaccgactgaatcgataa

DBGET integrated database retrieval system