KEGG   Tsukamurella paurometabola: Tpau_3430Help
Entry
Tpau_3430         CDS       T01228                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tpr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Tpau_3430
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tpr03011]
    Tpau_3430
Ribosome [BR:tpr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Tpau_3430
  Bacteria
    Tpau_3430
  Archaea
    Tpau_3430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ADG80014
UniProt: D5UWL5
Position
complement(3518434..3518844)
Genome map
AA seq 136 aa AA seqDB search
MSNDTVETNAAPQTASATAKFVRVTPMKARRVIDLVRGKDAEQALAILRFAPQAASEPVA
KVLASAIANAQNNLGLDPRTLVVSEAYANEGPTMKRIQPRAQGRAYRIRKRTSHITVVVE
SQESKKPAASRNRKGA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgacacagtcgaaaccaacgctgcgccccagaccgcgtccgcgaccgccaag
ttcgtgcgcgtcacgccgatgaaggcccgccgcgtgatcgacctggtccgcggtaaggac
gccgagcaggcgctcgccatcctgcggttcgcgccgcaggcggccagcgagccggtcgcg
aaggtgctcgcctcggcgatcgccaacgcgcagaacaacctgggtctcgacccgcgcacc
ctggtcgtctcggaggcgtacgccaacgagggcccgaccatgaagcgcatccagccgcgt
gcccagggccgtgcgtaccggatccgcaagcgcaccagccacatcacggtcgtggtggag
tcgcaggagtccaagaagcccgccgccagccggaaccggaagggagcgtaa

DBGET integrated database retrieval system