KEGG   Tsukamurella paurometabola: Tpau_3810Help
Entry
Tpau_3810         CDS       T01228                                 

Definition
(GenBank) DNA ligase I, ATP-dependent Dnl1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr03030  DNA replication
tpr03410  Base excision repair
tpr03420  Nucleotide excision repair
tpr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Tpau_3810
   03410 Base excision repair
    Tpau_3810
   03420 Nucleotide excision repair
    Tpau_3810
   03430 Mismatch repair
    Tpau_3810
Enzymes [BR:tpr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Tpau_3810
    6.5.1.6  DNA ligase (ATP or NAD+)
     Tpau_3810
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Tpau_3810
DNA replication proteins [BR:tpr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Tpau_3810
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Tpau_3810
DNA repair and recombination proteins [BR:tpr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Tpau_3810
   NER (nucleotide excision repair)
    Other NER factors
     Tpau_3810
   MMR (mismatch exicision repair)
    Other MMR factors
     Tpau_3810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ADG80387
UniProt: D5UYT4
Position
complement(3932306..3933925)
Genome map
AA seq 539 aa AA seqDB search
MMAGSLRRQRCPSALSSAYAAVVGPLRHNQEVLFADVVAASTEVGATRARTAKIAALTRL
LRDADAADVRPVVAWLSGSLLQERLGTGWRGVAKILDEQVAAATPSLTVADVSSAFDELA
GTAGAGSVARRGELLGALFGRATADEQRLLVGLITGEVRHGALAGVMTDAVAHAAGVPLA
TVRRAAMLSGSLPQTASAALAGGADALAGFGLEVLRGVSPMLASPADDLPAALADLGPEV
SVEFKLDGARIQVHRNGDAVRVYTRTLRDITDAVPEIVETAMALPCTSVVLDGESLALTD
AGRPRPFQETMSRFGSAGSMEDERSVLRPFFFDCLHLDGRDLLDEPLSARLAALEQVAGD
LRIPALTRPSVEQASAHLEAALAAGHEGVMVKGLDSPYAAGRRGRAWQKVKQSYTLDLVV
LGAEWGYGRRTGLLSNLHLGARDPDGGEPIMVGKTFKGLTDALLRWQTEEFPRHERQRSE
HTVYLRPEIVVEIELDGVQRSRRYPGGVALRFARVLRYRPDKTAAEADTIDAVRALLPG
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgatggccggctcgctgcgccggcaacggtgcccgagtgcgctgtcgtcggcttacgcc
gcggttgtcggacccctacgccacaatcaggaggtgctcttcgccgacgtcgtcgccgca
tccaccgaggtcggggcgacccgtgcccgcaccgccaagatcgcggcgctcacccgattg
ctgcgcgatgccgatgccgcggatgtccggccggtggtggcgtggctctcgggctcgctg
ctgcaggagcgcctgggcaccgggtggcgtggggtggcgaagatactggacgagcaggtg
gccgcggcgaccccgtctctcacggtcgcggacgtctcctcggccttcgacgagttggcg
ggcacagcgggcgcgggatcggtggcacggcggggagagctgctcggtgcactgttcggg
cgcgccacggccgacgaacagcggctgctcgtcggattgatcacgggcgaggtgcgccac
ggggcgctcgccggggtgatgaccgacgcggtggcccatgcagccggtgtaccgctggca
acggtccgccgcgccgccatgctctcgggctcgctgccccagaccgcgtccgccgcactg
gcgggtggggcagacgcactagccggattcgggctggaggtgctgcgcggggtatcaccg
atgctggcctctcccgcggacgatctgcccgccgcactggccgatctgggacccgaggtc
agcgtggagttcaagctcgacggtgcgcggatccaggtgcaccgcaacggcgatgcggtg
cgggtgtacacccgcacgttgcgcgatatcaccgacgcggtccccgaaatcgttgagact
gcgatggcgctgccgtgtacctccgtcgtgctcgacggcgaatccctcgcgctcaccgac
gcggggcggccccggcccttccaagagaccatgagtcggttcggctccgcgggatcgatg
gaggacgagcgctctgtattgcggccgttcttcttcgactgcctgcacctcgacggtcgc
gacctgctcgatgagccgctctcggcgcgcctcgcggcgctcgaacaggtggcgggcgat
ctgcgcatccccgcgttgacacggccatcggtggagcaggcctccgcgcacctggaggcg
gcgctcgcggcgggacacgagggcgtgatggtcaaggggctggactcgccctacgctgcg
ggccggcggggtcgtgcgtggcagaaggtgaagcagtcgtacacgctcgatctcgtggtg
ctgggcgccgaatggggatacggccggcgaaccgggctgctctcgaacctgcacctgggc
gcccgcgatccggatggcggcgagccgatcatggtgggtaagaccttcaaaggattgacg
gatgcgcttctgcgctggcagacggaggagtttccgcgccacgagagacagcggagcgag
cacaccgtgtacctgcggccggagatcgtggtcgagatcgagctcgacggggtgcaacgc
tcccgccgctatccgggaggcgtcgccctgcgcttcgcacgggtgctgcgataccggccc
gacaagacggcggccgaggccgacaccatcgacgccgtgcgcgcactcctacccgggtaa

DBGET integrated database retrieval system