KEGG   Tsukamurella paurometabola: Tpau_3814Help
Entry
Tpau_3814         CDS       T01228                                 

Definition
(GenBank) PPOX class putative F420-dependent enzyme
Organism
tpr  Tsukamurella paurometabola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Putative_PNPOx Pyridox_ox_2 Pyrid_ox_like CsiV
Motif
Other DBs
NCBI-ProteinID: ADG80390
UniProt: D5UYT7
Position
complement(3937306..3937803)
Genome map
AA seq 165 aa AA seqDB search
MGTNQRGQIQMSEAEIAEFLDHSRTATIATVGASGAPHLVAMWYAVIDGDLWIETKGKSQ
KVVNLRRNPAMSASIEAGDSYDQLRGVAIEGTAEIVDDEATVRAVCEQVYERYFGPYTDE
LRPAIDAMMNKRVAVRLRTARIRSWDHRKLGMGAMPVSGSTAKYL
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgggaacgaatcagcgcggccagatccagatgagcgaggcggagatcgccgagttcctc
gaccacagccgcaccgcgaccatcgctacggtcggtgcgagcggtgcgccgcacctcgtg
gccatgtggtacgccgtgatcgacggtgatctgtggatcgagaccaagggcaaatcgcag
aaggtggtgaacctgcgccgtaacccggccatgagcgcatccatcgaggcgggtgactcg
tacgaccagttgcgcggtgtcgcgatcgaaggcaccgccgagatcgtcgacgacgaagcc
acggtgcgcgcagtatgcgagcaggtctacgagcgctatttcgggccgtacaccgacgag
ctcaggccggcgatcgacgcgatgatgaacaagagggtcgcggtgcggctgcgcaccgcc
aggatccgcagctgggatcaccggaaactgggtatgggggcgatgccggtcagcggtagc
accgcgaagtacctgtag

DBGET integrated database retrieval system