KEGG   Tsukamurella paurometabola: Tpau_3816Help
Entry
Tpau_3816         CDS       T01228                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00071  Fatty acid degradation
tpr00280  Valine, leucine and isoleucine degradation
tpr00281  Geraniol degradation
tpr00310  Lysine degradation
tpr00360  Phenylalanine metabolism
tpr00362  Benzoate degradation
tpr00380  Tryptophan metabolism
tpr00410  beta-Alanine metabolism
tpr00627  Aminobenzoate degradation
tpr00640  Propanoate metabolism
tpr00650  Butanoate metabolism
tpr00903  Limonene and pinene degradation
tpr00930  Caprolactam degradation
tpr01100  Metabolic pathways
tpr01110  Biosynthesis of secondary metabolites
tpr01120  Microbial metabolism in diverse environments
tpr01130  Biosynthesis of antibiotics
tpr01212  Fatty acid metabolism
Module
tpr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Tpau_3816
   00650 Butanoate metabolism
    Tpau_3816
  Lipid metabolism
   00071 Fatty acid degradation
    Tpau_3816
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tpau_3816
   00310 Lysine degradation
    Tpau_3816
   00360 Phenylalanine metabolism
    Tpau_3816
   00380 Tryptophan metabolism
    Tpau_3816
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tpau_3816
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Tpau_3816
   00281 Geraniol degradation
    Tpau_3816
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tpau_3816
   00627 Aminobenzoate degradation
    Tpau_3816
   00930 Caprolactam degradation
    Tpau_3816
Enzymes [BR:tpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Tpau_3816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADG80392
UniProt: D5UYT9
Position
3939035..3939826
Genome map
AA seq 263 aa AA seqDB search
MTDAPHALVEQRGHTLIITMNRPEAKNALTGDMLRIMTESWDRIDSDPEIRSAILTGAGG
AFCAGADLKNMTKSNPGETMSSGGFDPARIPGLIKGRRPKKPLIAAVEGAAIAGGTELLQ
GTDIRVAAQSAKFGVSEAKWSLFPMGGSAVRLPRQIPYTVAADLLLTGRHISAAEALEYG
LVGHVVADDTALDKALELAELVNANGPLAVQAILRTMRETEGLHEEEAFRIDAALGLAVF
TSEDAKEGPRAFAEKRRPVFHGR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgccccacacgccctcgtcgaacagcgtggccacacgctgatcatcaccatg
aaccgaccggaggcgaagaacgcgctcaccggcgacatgctgcgcatcatgaccgagtcg
tgggaccggatcgactccgatcccgagatccgcagcgcgattctcaccggcgcgggcggc
gccttctgcgcaggcgcggatctgaagaacatgacgaagtccaatccgggtgaaaccatg
tcgagcggcggtttcgatccggcacggatccccggactgatcaagggccgccggccgaag
aagccgttgatcgccgcggtcgagggcgccgccatcgcgggcggcaccgagctgttgcag
ggaaccgatatccgagtcgcggcgcagagcgcgaagttcggtgtgtccgaggccaagtgg
agcctgttcccgatgggtggatccgccgtccggctcccgcgccagatcccgtacaccgtg
gcggcggacctcctactgaccggacggcacatctccgcagcggaggcgctggagtacggc
ctcgtcggccacgtggtggccgacgacaccgctctggacaaggcactcgagctcgccgag
ctggtgaacgccaatggccccctcgcggttcaggccatcctgcgcaccatgcgcgagacg
gagggcctgcacgaggaggaggccttccgcatcgatgcagccctcggcctggccgtcttc
acatccgaggacgcgaaggagggtccgcgcgccttcgccgagaagcgcaggcccgtcttc
cacggccgctga

DBGET integrated database retrieval system