KEGG   Tsukamurella paurometabola: Tpau_3820Help
Entry
Tpau_3820         CDS       T01228                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00071  Fatty acid degradation
tpr00072  Synthesis and degradation of ketone bodies
tpr00280  Valine, leucine and isoleucine degradation
tpr00310  Lysine degradation
tpr00362  Benzoate degradation
tpr00380  Tryptophan metabolism
tpr00620  Pyruvate metabolism
tpr00630  Glyoxylate and dicarboxylate metabolism
tpr00640  Propanoate metabolism
tpr00650  Butanoate metabolism
tpr00900  Terpenoid backbone biosynthesis
tpr01100  Metabolic pathways
tpr01110  Biosynthesis of secondary metabolites
tpr01120  Microbial metabolism in diverse environments
tpr01130  Biosynthesis of antibiotics
tpr01200  Carbon metabolism
tpr01212  Fatty acid metabolism
tpr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tpau_3820
   00630 Glyoxylate and dicarboxylate metabolism
    Tpau_3820
   00640 Propanoate metabolism
    Tpau_3820
   00650 Butanoate metabolism
    Tpau_3820
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Tpau_3820
   00072 Synthesis and degradation of ketone bodies
    Tpau_3820
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tpau_3820
   00310 Lysine degradation
    Tpau_3820
   00380 Tryptophan metabolism
    Tpau_3820
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tpau_3820
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tpau_3820
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Tpau_3820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tpr04147]
    Tpau_3820
Enzymes [BR:tpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Tpau_3820
Exosome [BR:tpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tpau_3820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Peptidase_M22 SpoVAD
Motif
Other DBs
NCBI-ProteinID: ADG80395
UniProt: D5UYU2
Position
3943504..3944679
Genome map
AA seq 391 aa AA seqDB search
MSAHRTAVLGTGQTHHRAKRTDVSMAGLIREAVDRALDDAGVAMADIDAIIIGKAPDMFE
GVMMPELFLADALGAVGKPLLRVHTAGSVGGSTAAVAAALVKAGVHRRVLTVAWEKQSES
NAMWALSIPVPFTVPVGAGAGGYFAPHVRSYIRLSGAPTHVGAMVAVKDRRNGALNPFAH
LHQPDITLESVQASQMLWDPIRFDETCPSSDGACAIVLGDEEAAAQSETTTGRRPGWVLA
TSMRTEPLAYAGREHVSPQAGRDAAAALWRDAGITDPLTQVDAAEIYVPFSWFEPMWLEN
LGFVGPGEGWKLTEAGETEIGGRIPVNPSGGVLSSNPIGASGMIRFAEAAKQVMGRAGDY
QVDGARTALGHAYGGGSQYFSMWLVGADKPA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgcaccgcaccgccgtactcggcaccggccagacccaccaccgcgccaagcgc
accgatgtctccatggccggactgatccgtgaggccgtcgaccgcgctctcgacgatgcc
ggtgtcgcgatggccgacatcgacgcgatcatcatcggcaaggcgcccgacatgttcgag
ggcgtgatgatgcccgagctgttcctggccgatgcgctcggcgccgtcggcaagccgctg
ttacgggtgcacaccgcaggatccgtgggcggatcgaccgcggcggtcgctgccgcactg
gtcaaggccggcgtacatcgccgtgtgctcaccgtcgcgtgggagaagcagtccgagtcg
aatgccatgtgggcgttgtcgatcccagtcccattcaccgtcccggtcggcgccggagcc
ggcggctacttcgcgccgcacgtgcgctcgtacatccggctctccggtgcgcccacacac
gtcggtgcgatggtcgcggtgaaggatcggcgcaacggcgcactgaatcccttcgcacat
ctacaccagcccgacatcacgctcgagtccgtccaggcctcccagatgctgtgggacccc
atccgattcgacgagacctgcccatcctccgacggcgcctgcgcgatcgtcctcggcgac
gaagaggcggcggcgcagtcggagacgacgaccggccgccggcccggatgggtgctcgcg
acgtcgatgcgtaccgaaccgctcgcctacgccggccgcgagcacgtgagtccgcaggca
ggccgtgacgccgcagccgcgctctggcgcgacgccggaatcaccgatccgctcacccag
gtcgatgccgccgagatctacgtcccgttctcctggttcgaaccgatgtggctggagaat
ctggggttcgtgggccccggcgagggatggaagctcaccgaggccggagagacggagatc
ggtggccggataccggtgaacccgtcgggtggggtgctgtcgtcgaatccgatcggcgcg
tcggggatgatccggttcgcggaagcagcgaagcaggtgatgggccgcgccggcgactat
caggtggacggtgcccgcaccgccctcggccacgcctacggcggcggatcccagtacttc
tcgatgtggctcgtaggcgccgacaagcccgcctga

DBGET integrated database retrieval system