KEGG   Tsukamurella paurometabola: Tpau_3827Help
Entry
Tpau_3827         CDS       T01228                                 

Definition
(GenBank) coenzyme A transferase
Organism
tpr  Tsukamurella paurometabola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: ADG80402
UniProt: D5UYU9
Position
3951035..3951907
Genome map
AA seq 290 aa AA seqDB search
MTDKRMTADEMVAQLRDGMTLGIGGWGSRRKPMALVRAILRSDLTDLTVVSYGGPDVGLL
AAAGKIRRLVFGFVTLDSVPIDPNFARARQSGAIEVSEWDEGMFAAGLKAAVQRLPFQPI
RAGLGSAVMSTNPDLKTVRSPYSDGEELVAVPPLHLDASLIHMNRADARGNAQYLGPDPY
FDDDFALAAERCYVSCEKIVSTEELAAGGPVQSLLINRSAVTGVIETPNGAHFTTAAPDY
GRDEKFQRHYAASAKSPDAWATFTERFLTGDEAHYQAEVAAWSAEQEDAK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagcgaatgacggcagacgagatggttgcccagctgcgcgacgggatgact
ctcggcatcggcggatggggctcacggcgcaagccgatggccctggtccgcgccatcctg
cggtcggatctcacggacctgaccgtggtctcgtacgggggccccgatgtgggcctgctc
gccgccgcgggcaagatccgccggctcgtcttcggtttcgtgaccctcgattcggtcccg
atcgatcccaacttcgcccgcgcccggcagtcgggtgccatcgaggtctcggagtgggac
gagggcatgttcgctgcgggcctcaaggcggccgtgcaacgccttcccttccagccgatc
cgtgccggactgggctctgcggtcatgagcaccaacccggacctgaagacggtgcgctcg
ccctactccgatggcgaggagctggtggccgtgccgccactgcacctcgacgcctcactg
atccacatgaatcgcgccgatgcccgcggcaacgcgcagtacctcggccccgacccctac
ttcgacgacgacttcgcgctggcggcggaacgctgctacgtctcgtgcgagaagatcgtg
agcaccgaggagctggcggccggtgggcccgtgcagtcgctgctgatcaaccgcagcgcc
gtgaccggagtgatcgagacgccgaacggcgcccacttcaccaccgccgccccggactac
ggacgggatgagaagttccagcgacactacgcggcgagcgcgaagtcccccgacgcatgg
gcgacgttcaccgagcgattcctcaccggcgacgaggcgcattaccaggcggaggtggcg
gcgtggtccgccgagcaggaggacgcgaaatga

DBGET integrated database retrieval system