KEGG   Tsukamurella paurometabola: Tpau_3831Help
Entry
Tpau_3831         CDS       T01228                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
Organism
tpr  Tsukamurella paurometabola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C Response_reg
Motif
Other DBs
NCBI-ProteinID: ADG80406
UniProt: D5UYV3
Position
3954774..3955487
Genome map
AA seq 237 aa AA seqDB search
MQILYLHSGAHPANVVPPEARLDAQGHSVFLAPVGEPVPVRALSDVGAVIIESDNGDAFD
ACRELRRLSDIPILMIGGQAKDEVHTITALTVGADDFVARPVSDREIDARLRAIRRRVRS
TGSCTLTCRTHEAGGTPASGTVVIEQSGLSIDPTTRSVSLDGDPVLLTTTETGLLLALAA
RRGVPQSRDSLLRQAWGHDYLGRSRIVDNAVQRLRSKIDTPKWHHVHSVRGYGYVLR
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
gtgcagatcctgtacctacacagcggggcccacccggccaacgtggtgcctcccgaagcg
cgattggatgcacaggggcacagcgtgttcctcgcgcccgtcggcgaaccggttcccgta
cgcgcactcagcgatgtcggggcagtcatcatcgaatccgacaacggcgacgccttcgat
gcctgtcgtgagctgcgccgcctcagcgacatacccattctgatgatcggcggacaagcc
aaggatgaggtccacaccatcacggcgctgaccgtgggagccgacgatttcgtggcccga
ccggtgtcggaccgggagatcgatgcgaggttgcgtgcgattcgacgccgcgtccgctcg
accggatcctgcacactcacctgccggacgcatgaggcgggcggcactccggccagcggc
acagtagtgatcgagcagagcgggctgtcgatcgatccgaccacgcgcagcgtctccctc
gatggcgatccggtcctgctgaccacgaccgagaccggacttctgctcgccctcgcggcg
cggcgcggcgtcccgcagtcgcgcgactcactgctgcgccaggcctggggacacgactat
ctgggacgctcgcgcatcgtcgacaacgcggtgcaacggctgcggtcgaagatcgacaca
cccaagtggcaccacgtccacagtgtccgcggatacgggtacgttctgcggtga

DBGET integrated database retrieval system