KEGG   Tsukamurella paurometabola: Tpau_3834Help
Entry
Tpau_3834         CDS       T01228                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00061  Fatty acid biosynthesis
tpr00780  Biotin metabolism
tpr01100  Metabolic pathways
tpr01130  Biosynthesis of antibiotics
tpr01212  Fatty acid metabolism
Module
tpr_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:tpr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Tpau_3834
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Tpau_3834
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Tpau_3834
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tpr01004]
    Tpau_3834
Enzymes [BR:tpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     Tpau_3834
Lipid biosynthesis proteins [BR:tpr01004]
 Fatty acid synthase
  Component type
   Tpau_3834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Motif
Other DBs
NCBI-ProteinID: ADG80409
UniProt: D5UYV6
Position
complement(3957267..3958079)
Genome map
AA seq 270 aa AA seqDB search
MSSDRPPAVPAIPAPPYPRGRNILEDRVVVVTAAAGTGIGSATAKRCLEEGARVVISDWH
ERRLSEKADELDADFSGRVHAITCDVTIEEQVQGLLDGAAGRFGRVDVLINNAGLGGSVA
VQDMTDEQWSRVLDVTLTGTFRATRAAINRFITQGGGGVIVNNASVIGWRAQAEQAHYAA
AKAGVMALTRCSAVDAAPHGVRINAVSPSIAMHPFLAKVTSDELLDELSRREVFGRAAEP
WEVANVIVFLASEYSSYLTGEVLSVSSQHA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagcgaccgtccgcccgccgtacccgcgatccccgcaccgccctaccccaggggc
cgcaacatcctcgaagaccgcgtcgtcgttgtcaccgccgcagccggtaccggcatcggc
tccgcgaccgccaagcgatgcctggaagagggcgcgcgcgtagtgatctcggactggcac
gagcggcggctgtcagagaaggcggacgagctcgacgccgacttcagcggccgcgttcat
gccatcacctgcgatgtgacgatcgaggaacaggtgcagggcctgctcgacggggcagcg
gggcggttcgggcgggtcgacgtgctgatcaacaatgccggacttggaggcagcgttgcg
gttcaggacatgaccgacgagcagtggtcgcgggtgctggacgtgacgcttaccggcacc
ttccgcgccacccgcgccgcgatcaaccgcttcatcacacagggcggcggcggagtgatc
gtcaataacgcttcggtgatcggctggcgtgcccaggccgagcaggcgcactacgccgcc
gcgaaggcgggcgtgatggcgttgacccgctgctccgccgtggatgccgctccgcacggc
gtacggatcaacgcggtctcgcccagcatcgcgatgcaccctttcctggcgaaggtgacc
tcggacgaattgctcgacgaactctcgcgccgtgaagtcttcggccgtgcggcggagccc
tgggaggtggcgaacgtgatcgtctttctggcgtcggagtactcgagttatctgacgggg
gaggtgctctcggtgagcagtcagcatgcctag

DBGET integrated database retrieval system