KEGG   Tsukamurella paurometabola: Tpau_3834Help
Entry
Tpau_3834         CDS       T01228                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00061  Fatty acid biosynthesis
tpr00780  Biotin metabolism
tpr01040  Biosynthesis of unsaturated fatty acids
tpr01100  Metabolic pathways
tpr01130  Biosynthesis of antibiotics
tpr01212  Fatty acid metabolism
Module
tpr_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:tpr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Tpau_3834
   01040 Biosynthesis of unsaturated fatty acids
    Tpau_3834
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Tpau_3834
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    Tpau_3834
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tpr01004]
    Tpau_3834
Enzymes [BR:tpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     Tpau_3834
Lipid biosynthesis proteins [BR:tpr01004]
 Fatty acid synthase
  Component type
   Tpau_3834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Motif
Other DBs
NCBI-ProteinID: ADG80409
UniProt: D5UYV6
Position
complement(3957267..3958079)
Genome map
AA seq 270 aa AA seqDB search
MSSDRPPAVPAIPAPPYPRGRNILEDRVVVVTAAAGTGIGSATAKRCLEEGARVVISDWH
ERRLSEKADELDADFSGRVHAITCDVTIEEQVQGLLDGAAGRFGRVDVLINNAGLGGSVA
VQDMTDEQWSRVLDVTLTGTFRATRAAINRFITQGGGGVIVNNASVIGWRAQAEQAHYAA
AKAGVMALTRCSAVDAAPHGVRINAVSPSIAMHPFLAKVTSDELLDELSRREVFGRAAEP
WEVANVIVFLASEYSSYLTGEVLSVSSQHA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagcgaccgtccgcccgccgtacccgcgatccccgcaccgccctaccccaggggc
cgcaacatcctcgaagaccgcgtcgtcgttgtcaccgccgcagccggtaccggcatcggc
tccgcgaccgccaagcgatgcctggaagagggcgcgcgcgtagtgatctcggactggcac
gagcggcggctgtcagagaaggcggacgagctcgacgccgacttcagcggccgcgttcat
gccatcacctgcgatgtgacgatcgaggaacaggtgcagggcctgctcgacggggcagcg
gggcggttcgggcgggtcgacgtgctgatcaacaatgccggacttggaggcagcgttgcg
gttcaggacatgaccgacgagcagtggtcgcgggtgctggacgtgacgcttaccggcacc
ttccgcgccacccgcgccgcgatcaaccgcttcatcacacagggcggcggcggagtgatc
gtcaataacgcttcggtgatcggctggcgtgcccaggccgagcaggcgcactacgccgcc
gcgaaggcgggcgtgatggcgttgacccgctgctccgccgtggatgccgctccgcacggc
gtacggatcaacgcggtctcgcccagcatcgcgatgcaccctttcctggcgaaggtgacc
tcggacgaattgctcgacgaactctcgcgccgtgaagtcttcggccgtgcggcggagccc
tgggaggtggcgaacgtgatcgtctttctggcgtcggagtactcgagttatctgacgggg
gaggtgctctcggtgagcagtcagcatgcctag

DBGET integrated database retrieval system