KEGG   Tsukamurella paurometabola: Tpau_3836Help
Entry
Tpau_3836         CDS       T01228                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K18687  HIP---CoA ligase [EC:6.2.1.41]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00984  Steroid degradation
tpr01100  Metabolic pathways
tpr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tpr00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Tpau_3836
Enzymes [BR:tpr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.41  3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoate---CoA ligase
     Tpau_3836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C SpoVAD AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ADG80411
UniProt: D5UYV8
Position
3959347..3960879
Genome map
AA seq 510 aa AA seqDB search
MSGTIASVLHTAVERFADHPAVVDGDLRISYASLRDRSRSVAKALLAEGVRPGDRVAICA
PNGHEWIEAALGLATIGAVLVPVNTRYTGPEIVDLLERTRARAFVVAGTFLGVDRLNLVH
QSAGGLPENVATVLRLPEWDSLAARGSGITDTELDVIGAEVTPQSPSDIFFTSGTSGRSK
GAVSTHAQTLANAANWAELVGVTDTDRYLILSPFFHIFGYKAGILAALQRGATMYPAQTF
DVVQAFDLIHRERISVLPGVPTIHQMMLDHPDREKYDLSSLRAATTGAATIPVVLIERMR
DELRYDRVLTAYGLSEAPVVTMCRADDDPAVIATTSGRAVRDMQVRIADDGEILVRGPNV
IAEYFEDPDATARAFDADGWFHTGDAGSMDEAGNLRITDRIKDMFTNGGFNVYPAEVEQV
IARIEGVAESAVVGVPEPRLGEVGKAFVVLTGSRELTEDAVIAHCRESLANFKVPRSVEF
VSELPRNATGKVLKRVLRGEPDPAPGEKNR
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcaccattgcatcggtcctgcacaccgccgtcgagcggttcgcggaccacccc
gcagtggtcgacggggatctgcgcatcagctacgcgtcgctccgcgatcggtcgcggtca
gtggcgaaggcattgctcgcggagggagtgcgaccgggagaccgggtggcgatctgtgcg
ccgaacggccacgagtggatcgaggccgccctcggcctcgccaccatcggtgcggtactc
gtaccggtgaacacccgctacacgggtccggagatcgttgatctgctcgagcgcacccgc
gcccgcgccttcgtcgtcgccggcacgttcctcggcgtcgaccgcctgaacctagtacac
cagagcgccgggggactgcccgaaaacgtcgcgacggtgctgcgcctgcccgagtgggac
tcgttggccgcgcgcggatccggcatcaccgacacggaactcgacgttatcggcgccgag
gtcactccgcagtcaccatcggacatcttcttcacttccggtacgtcgggccggagcaag
ggcgcggtgagcacgcatgcgcagacgctcgcgaatgcggcgaactgggccgaactcgtc
ggcgtcaccgacaccgaccgttacctgatcctgagcccgttcttccacatcttcggatac
aaggcgggcatcctggcggcactgcagcgcggcgcaacgatgtatcccgcgcagaccttc
gatgtggttcaggccttcgatctcattcaccgcgaacgcatctcggttctcccgggcgta
ccgacgatccatcagatgatgctcgaccatccggaccgtgagaagtacgacctgtccagt
ctgcgcgccgcgaccaccggcgccgccacgatcccggtggtactcatcgagcggatgcgc
gacgagctgcggtacgaccgcgtgctcaccgcgtacgggctctccgaggcacccgtggtc
acgatgtgccgggccgacgacgatcccgccgtcatcgccaccacatcgggccgggcggtg
cgcgacatgcaggtgcggatcgccgacgatggcgaaatcctggtacgcggtcccaacgtg
atcgcggagtacttcgaagatccggatgccaccgcccgagccttcgacgccgacggttgg
ttccacaccggcgacgccgggagcatggacgaggcgggcaatctccggatcaccgaccgg
atcaaggacatgttcaccaacggcggcttcaacgtctatccggccgaggtggagcaggtg
atcgcgcggatcgagggggttgccgagagcgccgtcgtcggcgtccccgagccacggctc
ggcgaggtgggcaaagccttcgtggtactcaccgggagccgcgagctcaccgaggatgcg
gtgatcgcgcactgccgcgagtcgctcgccaacttcaaagtccctcgcagcgtggaattc
gtcagcgaacttccccgcaacgcaaccggaaaggtgctcaaacgcgttctccgcggcgag
cccgatcccgcaccaggagagaagaatcgatga

DBGET integrated database retrieval system