KEGG   Tsukamurella paurometabola: Tpau_3838Help
Entry
Tpau_3838         CDS       T01228                                 

Definition
(GenBank) acyl-CoA dehydrogenase domain protein
Organism
tpr  Tsukamurella paurometabola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_N Acyl-CoA_dh_1 Acyl-CoA_dh_M
Motif
Other DBs
NCBI-ProteinID: ADG80413
UniProt: D5UYW0
Position
3961781..3962938
Genome map
AA seq 385 aa AA seqDB search
MDLDFDDATVAFRDEVRSWLTTNVPAEPLPSFDTAEGFAAHRRWEGKLADAGLAAVSWPA
EFGGRDATLLQWVLFEEEYYAAGAPLRVNQNGLFMLAPTLFSHGTDEQRARILPAMARSE
RVWAQAWSEPEAGSDIAALRSTASRVEGGWRLSGQKTWSSRAAFADSAFGLFRSDPGSER
HRGLTYLMFDLHAPGVTVRPIPQLDGEPGFAEIFLDEVFVPDADVIGEPGQGWRVAMTTA
NNERGLSLRSPGRFLSAADALVGLWDREDGAAGTTADRVVDAWIGARAYQLYTFGTVTRL
QEGGELGPESSVNKLFWSHLDVGMHETALDLLGPRGELVGPDAPDGGRWPAGYLFSLAGP
IYGGTDQIQRNTIAERLLGLPRGAR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtggacctcgatttcgacgatgccacggtcgcgttccgggacgaggtgcgtagctggctc
accacgaacgtcccagccgaaccgctgccgtccttcgacaccgccgagggattcgccgca
caccgcaggtgggagggcaagctcgccgacgccggcctcgccgcggtctcgtggccagcg
gagttcggtggccgggacgccaccctgctgcagtgggtgctgttcgaagaggagtactac
gccgcgggcgcaccgctacgggtgaaccagaacggccttttcatgttggcgcccacactc
ttcagccacggcaccgacgagcaacgggcacgcattcttcccgccatggctcgttccgag
cgagtgtgggcacaggcgtggtcggaacccgaggccggcagcgatatcgcggccctgcgg
tcgaccgcgagccgcgtcgagggcggctggaggctctcgggccagaagacctggagttcg
cgggccgccttcgcagacagcgccttcggcctgttccgcagtgatcccggctcggagcgc
caccgcgggctgacctacctgatgttcgacctgcacgcccccggggtcaccgttcgtccg
ataccccaactcgacggagaacccggcttcgccgagatcttcctggacgaggtgttcgta
cccgatgccgacgtgatcggcgagcccggccagggctggcgggtggcgatgaccactgcg
aacaacgagcgcggcctgtcgttgcggagcccgggacggttcctctccgcagcggacgct
ctggttggcctgtgggaccgggaggacggtgcggccggcaccacggcggaccgggtcgtc
gacgcctggatcggcgcgcgggcctaccagctctacaccttcggcaccgtcacccggctg
caggaaggcggcgagctcggccccgaatcgagcgtgaacaagctgttctggagccatctc
gacgtgggtatgcacgagaccgcactggatctgctcggcccgcgcggcgaactcgtcgga
cccgacgcacccgacggcggccggtggccggcgggatacctgttctcactggccggtccc
atctacggtggcaccgatcagatccagcgcaacaccatcgccgaacgtctgctcggccta
cctcggggagcccgatga

DBGET integrated database retrieval system