KEGG   Tsukamurella paurometabola: Tpau_3841Help
Entry
Tpau_3841         CDS       T01228                                 

Definition
(GenBank) methyltransferase
Organism
tpr  Tsukamurella paurometabola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LCM
Motif
Other DBs
NCBI-ProteinID: ADG80416
UniProt: D5UYW3
Position
3965060..3965977
Genome map
AA seq 305 aa AA seqDB search
MTDSVRTEGDTWDITTSVGFTALLVAAARAVEADRADALARDPYARIFIEAAGDPRTQAM
LNSAEGADGPLSASRHLGIRTKFFDDFVTDAVAAGIRQVVILASGLDTRGYRLDLPTDTV
VYELDQPEVLAFKTETLAAHGATAAAGLHTVGIDLRENWPAALVGTGFDATAPSAWLAEG
LLPYLPADAQALLFERIVELAAPGSRAAVEGQTGAFDLDGFRALQQKYATPDNPLGDFDV
TSLFLADAEREDPADYLAGQGWTVRREGGPVELSERYGVGGAVLPDDAARLSGVIEYFTA
ELPRS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgacggacagcgtgcgcaccgaaggcgatacctgggacatcaccaccagcgtcgggttc
accgccctcctcgtggccgcggcacgggccgtcgaggccgatcgggcagacgcgctcgcc
cgagacccgtacgcgcggatcttcatcgaggccgcgggcgatccgcgtacgcaggcgatg
ctgaactccgccgagggtgccgacggtcccctgagcgccagccgccacctcggcatccgg
accaagttcttcgatgacttcgtgaccgacgccgtcgccgccggcatccgccaggtggtc
atcctcgcgtcaggactcgacacccgcggctaccggcttgatctccccaccgacaccgtg
gtctacgagctcgaccagcccgaggtactggccttcaagacggagaccctcgccgcgcac
ggcgcgactgcggccgccggcctgcacaccgtggggatcgacctgcgcgagaactggccg
gccgcgctggtgggtaccggatttgatgcgactgcaccgtctgcctggctggccgaagga
ctgctcccctaccttcccgccgatgcgcaggccctgctgttcgagcggatcgtcgaactc
gccgcacccggtagccgggcagccgtggagggccagaccggcgcattcgacctcgacggc
ttccgcgcgctccagcagaagtacgcaacgcccgataacccgctcggtgacttcgacgtc
acctcgctgttcctcgccgacgccgaacgtgaggatccggcggactacctggccggccaa
ggctggacggtgcggcgcgagggcggccccgtggagctcagcgagcggtacggcgtggga
ggcgcggttctgcccgacgacgcggcgcggctgtccggcgtcatcgagtacttcaccgcg
gagctacctcgcagctga

DBGET integrated database retrieval system