KEGG   Tsukamurella paurometabola: Tpau_3844Help
Entry
Tpau_3844         CDS       T01228                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
  KO
K16050  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase [EC:3.7.1.17]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00984  Steroid degradation
tpr01100  Metabolic pathways
tpr01120  Microbial metabolism in diverse environments
tpr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tpr00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Tpau_3844
Enzymes [BR:tpr01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.17  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase
     Tpau_3844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 DUF1057 Ndr
Motif
Other DBs
NCBI-ProteinID: ADG80419
UniProt: D5UME5
Position
complement(3967528..3968397)
Genome map
AA seq 289 aa AA seqDB search
MPETEVDVLKEGKFATTAAGLTLHYHEAGEENRDSGTVVLLHGSGPGVSSWSNFGRNIPV
LAQRFHVLAVDQPGFGRSDKPTEHPQYFVHSATALAGLLDALGITERVHLVGNSLGGGTA
VRFALDFPERAGRLVLMGPGGLSVNTFAPDPTEGLRTLQRFYAAPSKERLEDFLRIMVFD
QKMITPELIEERFDLALDPEAIAAFTAMGKSFASADYEKGMLWRDAYKLRQPVLMIWGRE
DRVNPLDGALLALKQIPRAQLHVFGQCGHWAQLEKFDEFNRLTADFLAG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagaccgaggtcgatgtcctcaaggagggcaagttcgccaccaccgcagccggt
ctcacgctgcactaccacgaggccggcgaggagaaccgcgacagcggcaccgtggtgctg
ctgcacggaagcggtcctggcgtgtcgtcgtggagcaacttcgggcgcaacattccggtg
ctggcgcagcggtttcacgtgctcgcggtcgatcagccgggtttcggccggtccgataag
ccgaccgagcatccgcagtacttcgtgcacagcgccacggcgctcgccggactcctcgac
gcgctcggcatcaccgaacgtgtgcacctggtgggcaattcgctcggcggcggtacggcc
gtgcggttcgcgctggactttccggagcgcgcggggcggcttgtgctcatgggacccggc
gggctcagcgtgaacaccttcgcccccgatcccaccgagggcttgcggacgctgcagagg
ttctacgccgcaccgagcaaggagcggctcgaagacttcctgcggatcatggtgttcgac
cagaagatgatcacccccgagctcatcgaggagcggttcgatctcgcgctcgatcctgaa
gcgatcgccgccttcacggccatggggaagtcgttcgcctccgcggattacgagaagggc
atgctctggcgtgatgcctacaagctgcgccagcccgtgctcatgatctggggccgggaa
gacagggtcaacccgctcgacggtgcgctgcttgcgctcaagcagattccgcgcgcccag
ttgcacgtcttcggacagtgcggccactgggctcagctcgagaagttcgacgagttcaac
cggctcacggccgatttcctggccggctga

DBGET integrated database retrieval system