KEGG   Tsukamurella paurometabola: Tpau_3847Help
Entry
Tpau_3847         CDS       T01228                                 

Definition
(GenBank) hypothetical protein
Organism
tpr  Tsukamurella paurometabola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAP
Motif
Other DBs
NCBI-ProteinID: ADG80422
UniProt: D5UME8
Position
3971486..3971902
Genome map
AA seq 138 aa AA seqDB search
MTHRLDTSGRGAGPLRGYSGRFLAIAAAAAICATAVAVALSLGPRGDTAPAPAASPSSRP
ATPIASSATAPPATSTTVPGAAPAPTRPVIAPTATTTEAQATVAPPRTTAPRSAPCTPRQ
KWVFRPSTGTYERMTLPC
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgacccaccgcctcgacacgtccggcaggggagcgggacctctgcgcggatactccgga
cgattcctcgcgatcgcggccgccgcagcgatctgtgcgaccgccgtcgcagtggcgctc
agtctgggcccgcgcggcgacacggcccccgcaccggcggcgtcgccgtcatcgcgcccg
gcgacgcccatcgcatcgagcgccaccgccccaccggcgacatcgacgacggtgcccggc
gctgcgccggccccgacccgacccgtcatcgctcccacggcgaccaccaccgaggcgcag
gcgaccgtggctcctccgcgaacgacagcaccgcgctcggcgccgtgcacgccccggcag
aagtgggtcttccgccccagcaccggcacctacgagcggatgactctgccctgctga

DBGET integrated database retrieval system