KEGG   Tsukamurella paurometabola: Tpau_3850Help
Entry
Tpau_3850         CDS       T01228                                 

Definition
(GenBank) hypothetical protein
Organism
tpr  Tsukamurella paurometabola
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADG80425
UniProt: D5UMF1
Position
3974938..3975288
Genome map
AA seq 116 aa AA seqDB search
MSPTVTMFGEPVTDPATVADRQGFLTDGFTPLNCGTCGVAVQVRKNSREQTSIQWCGSAR
DCAVFASDGAGSALHATCPRLMESITRAAKLGAVPIPTPLPSSESVPADSVPSEVD
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccacggtgacgatgttcggcgaaccggtcacggatccggccacggtggccgat
cgacagggcttcctcaccgacggcttcaccccgctgaactgcggcacctgcggtgtggca
gtgcaggtgcgcaagaacagtcgcgaacagacctccatccagtggtgcggctccgcccgg
gactgcgcggtattcgcctccgacggtgccggatccgccctgcatgccacctgtccgcgc
ctgatggaatcgatcacccgcgcggcgaagctgggcgcggtcccgattccgacgccgctc
ccatcctcggaatccgttcccgccgactctgtcccgtcggaagtcgattag

DBGET integrated database retrieval system