KEGG   Tsukamurella paurometabola: Tpau_3851Help
Entry
Tpau_3851         CDS       T01228                                 

Definition
(GenBank) ferredoxin
  KO
K15983  3-ketosteroid 9alpha-monooxygenase subunit B [EC:1.14.15.30]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00984  Steroid degradation
tpr01100  Metabolic pathways
tpr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tpr00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Tpau_3851
Enzymes [BR:tpr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.30  3-ketosteroid 9alpha-monooxygenase
     Tpau_3851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2 NAD_binding_1 FAD_binding_6 NAD_binding_6 Fer2_4
Motif
Other DBs
NCBI-ProteinID: ADG80426
UniProt: D5UMF2
Position
3975302..3976384
Genome map
AA seq 360 aa AA seqDB search
MSIHRLLVAKVVAETHDAHSIEFEVPAELADRFTYKPGQFLTVRVPSEQTGSVARCYSLC
SAPHDGGPLRVAVKRTADGYASNWLCDNATPGMELDVLVPAGIFTPKSVDTAMLLFAGGS
GITPILSILCSVLETGTGSVAMIYANRDAQSVIFASALAELTRKYPDRLVVVHWLESVQG
LPSAANLAALAAPYASREVFVCGPGPFMDAVSEAMTSLGKGRREVHIEKFRSLPRNPFEV
EPSKEEAEERAALAEAEDLPAEDTPSPADDGGTVTIELDGKTTELAWPAEKKLLDVMLNA
GLDAPYSCREGACSACACRIVEGEVELAHNEVLDQDDLDDGLILACQSLRRTQSVHITYE
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatccaccgactgctcgtcgccaaggtggtcgcggagacgcacgacgcgcactcg
atcgagttcgaggtgcccgccgagctggcggaccggttcacctacaagcccggccagttc
ctcactgtccgagtaccgagcgagcagaccgggtcggtagcccggtgctattcgctgtgc
agcgcaccgcacgacggtggcccgttgcgggtagcggtcaagcgcaccgccgacggttac
gcgtcgaactggttgtgcgataacgcgacccccggcatggagctggacgtgctggtgccg
gcgggaatcttcacgccgaagtccgtcgacaccgccatgctgcttttcgccggcggcagc
ggtatcacgccgatcctgtcgatcctgtgtagcgtcctggagaccggtaccggctcggtg
gccatgatctacgccaaccgcgatgcgcaatcggtgatcttcgcctccgccctggccgaa
ctcacccggaagtatcccgaccggctggtcgtggtgcactggctcgaatcggtgcagggc
ctgcccagcgcagcgaacctggcggcgctcgccgcgccctacgcctcgcgcgaggtgttc
gtgtgcggccccgggcccttcatggacgcggtctccgaggcgatgacctcactcggcaag
gggcgccgcgaggtgcacatcgagaagttccgctcgctgccccgcaaccccttcgaggtc
gaaccgtcgaaggaggaggccgaggagagagccgcactcgccgaggccgaggatctgccc
gctgaggacacaccctcgcccgccgacgacgggggcaccgtgaccatcgagctagacggg
aagaccaccgaattggcctggcccgcagagaagaagctgctcgacgtgatgctcaatgcc
ggcctcgacgctccatactcgtgccgcgaaggcgcgtgtagcgcgtgcgcctgccggatc
gtcgagggcgaggtggagctcgcgcacaacgaggtactcgatcaggacgacctcgacgac
ggtctcatcctggcgtgccaatccctgcgtcgcacgcagtccgtccacatcacgtacgag
tag

DBGET integrated database retrieval system