KEGG   Tsukamurella paurometabola: Tpau_3857Help
Entry
Tpau_3857         CDS       T01228                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tpr  Tsukamurella paurometabola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MaoC_dehydratas HlyD
Motif
Other DBs
NCBI-ProteinID: ADG80432
UniProt: D5UMF8
Position
3981862..3982278
Genome map
AA seq 138 aa AA seqDB search
MSYPQTLRLCEVTVGTALPPLTIDASPTFVTSTAIATRDFQDVHHDRDAAHARGSKDIFV
NILTDNGLVQRYMTDWAGPEAFVCAIDIRLGVPCYAYDTLTFSGTVTEIDGDRVIVAVTA
KDSLGDHITGTATVVLPG
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgagctatccgcagaccctgcgcctgtgcgaggtgacggtgggaaccgcgctccccccg
ttgacgatcgacgcctcccccacgttcgtgacgagcacggccatcgcgacccgcgacttc
caggacgtgcatcacgaccgggacgccgcgcacgcgcgcggcagcaaggacatcttcgtg
aacatcctcaccgacaacgggctggtccagcggtacatgaccgattgggcgggcccggag
gcgttcgtgtgcgctatcgacatccggctcggcgtgccctgctacgcctacgacacgctc
accttctccggcaccgtcaccgagatcgacggcgatcgagtgatcgtagccgtgaccgcg
aaagacagtctgggcgaccacatcaccggcacggccaccgtggtgctgccgggatga

DBGET integrated database retrieval system