KEGG   Tsukamurella paurometabola: Tpau_3860Help
Entry
Tpau_3860         CDS       T01228                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tpr  Tsukamurella paurometabola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4381
Motif
Other DBs
NCBI-ProteinID: ADG80435
UniProt: D5UMG1
Position
complement(3984090..3984779)
Genome map
AA seq 229 aa AA seqDB search
MAATSETGEATEAGEIAGADRSDAETKPVSTAVKPATKKPAPAASETPKGVTVSPLALGL
AALVIVLAVAATAFGFLWMSAVSDRNDAQSQLSSMQATADQNKRAEDIATKYAIGAATVD
YQNLQPWRTALGANTTPGLATTLQQASTELEQVFVPMQWQSTATPLGSVVKSNQDGVIQA
NVFVNVITKSTQRPQGIPSVATYAVTIDTKQNWMITDVSGIDSALGGGK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggccgccacatcggagaccggcgaggcaacggaagccggcgagatcgccggagctgac
cgatccgacgcggagacgaagcctgtttccaccgcggtgaagccggcgacgaaaaagccc
gctccggcggcatccgagacgccgaagggcgtcaccgtctctccgctcgcactggggctc
gccgcgctcgtcatcgtgctcgccgtcgccgccacggccttcggtttcctctggatgtcc
gcggtatcggaccggaacgacgcgcaatcccagctctcctcgatgcaggcgactgcggat
cagaacaagcgcgcggaagacatcgccaccaagtacgcgatcggcgccgccaccgtcgat
taccagaacctccagccgtggcgaaccgccttgggcgccaacaccaccccggggctcgcg
actactctgcagcaggcatccacggagctggagcaggtcttcgtgccgatgcagtggcaa
tccaccgccaccccgctcggttcggtggtgaagtccaaccaggatggcgtgatccaagcc
aatgtcttcgtcaacgtgatcaccaagagcacgcagcggccgcagggtattccgtcggtc
gcgacttacgcagtcaccatcgacaccaaacagaactggatgatcaccgacgtcagcggc
atcgattccgcgctcggcggcggcaagtag

DBGET integrated database retrieval system