KEGG   Tsukamurella paurometabola: Tpau_3871Help
Entry
Tpau_3871         CDS       T01228                                 

Definition
(GenBank) bifunctional deaminase-reductase domain protein
Organism
tpr  Tsukamurella paurometabola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RibD_C
Motif
Other DBs
NCBI-ProteinID: ADG80446
UniProt: D5UMH2
Position
3993699..3994241
Genome map
AA seq 180 aa AA seqDB search
MGSIHAHEFVTLDGYFDDPSFTVPFGFDPAMGETLGAITGAASDILLGRNTYEMFAPAWR
DRTPEDDPGAPFFNETTKHVVGANPLVEQWNNTVPLGAYDPAKIAELKASSAGDIYISGS
GRLVRALLREGLLDSLHLFVYPVVLGTGERLFADDQLTLALQESQAYDNGVLHLAYGPAA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcatccacgcacacgaattcgtcacgctcgacggctatttcgatgaccccagt
ttcaccgtcccgttcggattcgatccggcgatgggcgagacgttgggcgcgatcaccggg
gcggcgagcgatatcctgttgggccgcaacacgtacgagatgttcgcgccggcttggcgc
gaccgcacgccggaggacgatccgggtgccccgttcttcaacgagaccaccaagcacgtg
gtgggggcgaacccgctcgtcgagcagtggaacaacacggtgcctctgggcgcgtacgac
ccggcgaagatcgccgagctgaaggcgtcgagcgcgggcgacatctacatcagcggcagc
ggccggctggtgcgggccctgctccgcgagggtctcctcgattcgctgcacctgttcgtc
taccccgtggtgctcggcacgggcgagcgcctgttcgccgatgaccagctgacgctggcc
ctccaggagtcgcaggcctacgacaacggcgtactgcacctcgcgtacgggcccgccgcg
tag

DBGET integrated database retrieval system