KEGG   Tsukamurella paurometabola: Tpau_3883Help
Entry
Tpau_3883         CDS       T01228                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tpr  Tsukamurella paurometabola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_5 TPR_14 ANAPC3 TPR_16 TPR_15
Motif
Other DBs
NCBI-ProteinID: ADG80456
UniProt: D5UMI2
Position
4008076..4008549
Genome map
AA seq 157 aa AA seqDB search
MTWEDDLEAAWAADLGDAELRARIDRIVSDPSVPAGVAAFERAGVEDSTGHPDRAVPGYR
RALDAGLDDSRARQATIQLASSLRNLGEAADGLALLNGLATDRGDGLDGAIAVFRALCLA
DLQRPNEAIAMLIDSVAEGMTRYRRSAQAYADELRTR
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgacctgggaggacgacctcgaagccgcatgggcggccgacctcggtgacgccgagctg
cgggcgcggatcgaccgcatagtcagcgatccctcggtgcccgcaggcgtcgccgcattc
gagcgggccggagtcgaggattcgaccgggcaccccgatcgcgccgtgcccggctaccgc
cgcgcgctcgatgctgggctcgatgacagtcgtgcccggcaggcgacgatccagctcgcg
agctcgctgcgcaacctcggcgaggccgcagacggactggcattgctcaacggtctcgct
accgaccgcggcgacggtctcgacggtgcgatcgccgtcttccgggcgctgtgtcttgcg
gacctgcagcgcccgaacgaggcgatagcgatgctcatcgactcggtggccgagggcatg
acacgatatcgtcgctccgcccaggcgtacgccgacgagctacgcacccgctga

DBGET integrated database retrieval system