KEGG   Tsukamurella paurometabola: Tpau_3887Help
Entry
Tpau_3887         CDS       T01228                                 

Definition
(GenBank) hypothetical protein
Organism
tpr  Tsukamurella paurometabola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigA
Motif
Other DBs
NCBI-ProteinID: ADG80460
UniProt: D5UMI6
Position
4009596..4009778
Genome map
AA seq 60 aa AA seqDB search
MSEPYISKSQYLAMFALPEQTSAELISRVQDALGITVHELGAAAAGTTVEEFAAFWEHAR
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagccgtacatcagcaagagccaatacctcgccatgttcgcgctacccgagcag
acctccgccgaactgatctcgcgcgtccaggatgcgctggggatcaccgtccacgaactt
ggcgccgccgcggccgggacgacggtcgaggagttcgcagcgttctgggaacacgcccgg
tga

DBGET integrated database retrieval system