KEGG   Tsukamurella paurometabola: Tpau_3895Help
Entry
Tpau_3895         CDS       T01228                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tpr  Tsukamurella paurometabola
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADG80467
UniProt: D5UMJ3
Position
4015314..4015904
Genome map
AA seq 196 aa AA seqDB search
MTERAVIDGFDSWLQRLGEKTARAVLELLEVYRAGQVDEAVFAEALGQMVAAVNSSARAA
ADVVAARAVETVLGERVTATGSAAVSAVEDHGRLARAAATFAGILADEDVDARLERFARD
EPAQAAQQQVVHSYKSHGIDGYTRGLNAGACELCVWLRKEHLRPGGFVYPASKPMHRHTG
CRCTPIPTRKEIDNDE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaacgggcggtgatcgacgggttcgactcgtggcttcagcgcctcggggagaag
accgcgcgtgctgtccttgagctgcttgaggtgtaccgggccggtcaggttgacgaggcg
gtgttcgcggaggctctggggcagatggtggcggcggtgaactcgtcggcgcgggccgcg
gccgatgtggttgctgcccgcgcggtggagaccgttcttggtgagcgggtcaccgcgacg
ggttcggcggcggtgtcggctgtggaggatcacggccggcttgctcgtgccgctgccacg
tttgccggcattctcgccgatgaggacgtggacgccaggttggagcggttcgctcgcgat
gaacccgcgcaggcggcacagcagcaagtcgtgcactcctacaagtcgcacgggatcgac
gggtacacacgcggcctgaacgccggggcctgcgaactctgcgtgtggctgcggaaggaa
catctgcggccgggcgggttcgtctacccggccagcaagccgatgcaccggcacaccggg
tgccggtgcacaccaatacctaccaggaaagagattgacaatgacgagtga

DBGET integrated database retrieval system