KEGG   Tsukamurella paurometabola: Tpau_3897Help
Entry
Tpau_3897         CDS       T01228                                 

Definition
(GenBank) hypothetical protein
Organism
tpr  Tsukamurella paurometabola
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADG80469
UniProt: D5UMJ5
Position
4016274..4016573
Genome map
AA seq 99 aa AA seqDB search
MIVEPNVTALAVGHLQRGMLRHFNDDVPVAAEHDTGSWRFLWCWASGGGHASAAPGARVG
GWCWVQAARRLSGPNMAEDPSRNDVLCWEAVVEWRVRVA
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtcgaaccgaacgtgactgccctggcggtcggccacctgcagcgggggatgctc
cgtcacttcaacgatgacgtgccggtggcggcggagcacgacacgggctcgtggcggttc
ctgtggtgctgggcgtcgggtggcggccacgcgtcggcggcgccgggggcacgcgtgggc
ggctggtgctgggtgcaggctgcgcggcggttgagcggcccgaacatggcggaggatccg
tcgcgtaacgacgtcttgtgctgggaggcagtggtggagtggcgggttcgcgtcgcttag

DBGET integrated database retrieval system